SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000009404 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000009404
Domain Number 1 Region: 450-524
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 1.59e-19
Family Double-stranded RNA-binding domain (dsRBD) 0.0021
Further Details:      
 
Domain Number 2 Region: 330-407
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 3.31e-18
Family Double-stranded RNA-binding domain (dsRBD) 0.002
Further Details:      
 
Domain Number 3 Region: 560-634
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 1.36e-17
Family Double-stranded RNA-binding domain (dsRBD) 0.0025
Further Details:      
 
Domain Number 4 Region: 28-89
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000000358
Family Z-DNA binding domain 0.00091
Further Details:      
 
Domain Number 5 Region: 128-196
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000000405
Family Z-DNA binding domain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000009404   Gene: ENSAPLG00000009658   Transcript: ENSAPLT00000010096
Sequence length 1067
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB744546.1:17116:27742:-1 gene:ENSAPLG00000009658 transcript:ENSAPLT00000010096 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPQHHGQNWERDSDTISLDFQQLSLAGQNHEQEILNIFRQLGVGKTCTVYDLARKLKTQK
KEVNRILYKLLREGKLHKGEETPPLWRIASPSTGRERNPRSGGGSAASASESRGERSAAS
SRDISPTMAETKDKICNYLFRVAETTALNLAKNIGFSKAKDVNAFLSALEKLGDVHKENS
NPPRWSLTDRKRERMQMRLKASAASRRADPVPGVSLPSSSGPADPQETTVAVASPAAGSS
VENGQQAAGQTDQSSDSDTEAAVPEDTKPVFSSFSTYDSSENGRWASDDIPDNLNTINVQ
PEDSESIMNSQASPSYAAQFDTGFPCTPVEKLLACQEKNPVSGLTEYSQYTSQHCDFEML
EQSGPSHEPRFKFQAVISGRRFPPAEAGSKKLAKQEAAANAMKVLMQEAENGRPDGIKCE
EPFPSNSSESELPLRSETESSSAPAQLNVLPGKHPISILMEYGQKSGNTIEFQLLSQDGP
PHDPRFSYCVKMGDQIFPAVVGNSKKGAKQMAAEVAMKILSGEPVPCASPEQSTRGCGAQ
VIAPDESKAAKAKGVGELIKYLNVNPVSGLLEYARSNGFAAEFKLIDQSGPPHDPKFVYQ
AKVGGRWFPAVTAHSKKQGKQEAADAALRVLIGETEKAERMEGINITEPCLSCTVQSSRK
MPSRATPSWSASPFQLPVSGSTLHDQMAMLSHQRFNALTARIQHSLLGRKILAAIIMRRK
NNDLGVVVSIGTGNRCVKGEELSLKGETVNDCHAEIISRRGFVRFLYSELMKYDPSNPSS
AEESIFEPAGKKRLKIKSNVTFHLYVSTAPCGDGALFDKSCSDQASVMGQAQHQPLFENP
KQGKLRTKVENGEGTIPVESSDIVPTWDGIQHGERLRTMSCSDKILRWNVLGLQGALLSH
FIEPVYLSSVTLGYLYSQGHLTRAICCRMVRDGDVLQKRLQAPYHINHPEVGRVSVYDSA
RQTGKTKESSVNWCLADESEVEVLDGTKGKVDGPKLEVSRVSKRKTFALFQQLCAKNKRK
DLQKFLVYSEAKEAATSYQEAKQRFFSALEEMGYGSWIRKPQEEDNF
Download sequence
Identical sequences U3IQ81
ENSAPLP00000009404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]