SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000009421 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000009421
Domain Number 1 Region: 7-111
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.63e-41
Family Interferon regulatory factor 0.0000023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000009421   Gene: ENSAPLG00000009708   Transcript: ENSAPLT00000010113
Sequence length 317
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB746227.1:80525:85284:-1 gene:ENSAPLG00000009708 transcript:ENSAPLT00000010113 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVSRMRMRPWLEMQINSNQIPGLIWINKDKMMFQIPWKHAAKHGWDMEKDACLFRSWAI
HTGRYKVGEKDPDPKTWKANFRCAMNSLPDIEEVKDKSINKGSSAVRVYRMLPPLTKDQK
KERKSKSSREARSRSKRKPYEDMRTEESAERLTNTPSTDDHSGYTVHDYTGQDVEVESPS
ITLDLSSCEVSGSLADWRTPMEIAMADSTNDIYQLQVSPPGSSSEVTDEDEDEMKANIFK
LLEPGQDWHTTSVGGKGFLTNEPGTQTMCSTYSYKDQDGEIDTSSGEMDFHAFDQKSSLE
FSWLDTVRPLQTISCGL
Download sequence
Identical sequences U3IQ98
XP_005030762.1.99704 ENSAPLP00000009421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]