SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000009452 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000009452
Domain Number 1 Region: 560-850
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.11e-83
Family Protein kinases, catalytic subunit 0.000000000528
Further Details:      
 
Domain Number 2 Region: 1-150
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.64e-67
Family Ephrin receptor ligand binding domain 0.0000021
Further Details:      
 
Domain Number 3 Region: 275-480
Classification Level Classification E-value
Superfamily Fibronectin type III 7.23e-42
Family Fibronectin type III 0.00015
Further Details:      
 
Domain Number 4 Region: 862-927
Classification Level Classification E-value
Superfamily SAM/Pointed domain 3.77e-19
Family SAM (sterile alpha motif) domain 0.0000621
Further Details:      
 
Domain Number 5 Region: 206-277,313-336
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000706
Family Growth factor receptor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000009452   Gene: ENSAPLG00000009611   Transcript: ENSAPLT00000010144
Sequence length 931
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743668.1:222070:309165:-1 gene:ENSAPLG00000009611 transcript:ENSAPLT00000010144 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WEEVSIMDEKNTPIRTYQVCNVMEPSQNNWLRTDWIPREGAQRVYIEIKFTLRDCNSLPG
VMGTCKETFNLYYYESNNDKERFIRESQFAKIDTIAADESFTQVDIGDRIMKLNTEIRDV
GPLSKKGFYLAFQDVGACIALVSVRVFYKKCPLTVRNLAQFPDTITGADTSSLVEVRGSC
VNNSEEKDVPKMYCGADGEWLVPIGNCLCNAGYEERNGECQACKIGYYKALSTDAACAKC
PPHSYSIWEGSTSCTCDRGFFRAENDAASMPCTRPPSAPQNLISNVNETSVNLEWSPPQN
KGGREDISYNVVCKRCGAGDLSRCRSCGSGVHFSPQQNGLKTTKVSITDLLAHTNYTFEV
WAVNGVSKHNPSQDQAVSVTVTTNQAAPSPIALIQAKEITRHSVALAWLEPDRPNGVILE
YEVKYYEKDQNERSYRIVKTASRNTDIKGLNPLTSYVFHVRARTAAGYGDFSGPFEFTTN
TVPSPIIGDGTNPTVLLVSVAGSVVLVVILIAAFVISRRRSKYSKAKQEADEEKHLNQGV
RTYVDPFTYEDPNQAVREFAKEIDASCIKIEKVIGVGEFGEVCSGRLKVPGKREICVAIK
TLKAGYTDKQRRDFLSEASIMGQFDHPNIIHLEGVVTKCKPVMIITEYMENGSLDAFLRK
NDGRFTVIQLVGMLRGIGSGMKYLSDMSYVHRDLAARNILVNSNLVCKVSDFGMSRVLED
DPEAAYTTRGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDV
IKAIEEGYRLPPPMDCPIALHQLMLDCWQKERSDRPKFGQIVNMLDKLIRNPNSLKRTGS
ESSRPSTALLDPSSPEFSASGGDWLQAIKMERYKDNFTAAGYTTLEAVVHMNQDDLARIG
ITAVVHQNKILSSVQAMRTQMQQMHGRMVPV
Download sequence
Identical sequences U3IQC9
ENSAPLP00000009452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]