SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000009461 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000009461
Domain Number 1 Region: 275-346
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.45e-17
Family PCI domain (PINT motif) 0.0000322
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000009461
Domain Number - Region: 112-196
Classification Level Classification E-value
Superfamily TPR-like 0.0284
Family Tetratricopeptide repeat (TPR) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000009461   Gene: ENSAPLG00000009737   Transcript: ENSAPLT00000010153
Sequence length 387
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742664.1:145161:153168:-1 gene:ENSAPLG00000009737 transcript:ENSAPLT00000010153 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RYRQILEKAIQLVGVEQLEALKAFVEASVSEPVVNENVSLVISRQLLTDFCTHLPSLPDS
TAKDIYHFTLEKIQPRVISFEEQVASIRQHLASIYEKEEDWRNAAQVLVGIPLETGQKQY
NVDYKLETYLKIARLYLEDDDPVQAEAYINRASLLQNESTNEQLQIHYKVCYARVLDYRR
KFIEAAQRYNELSYKSIVHESERLEALKHALHCTILASAGQQRSRMLATLFKDERCQQLA
AYGILEKMYLDRIIRGNQLQEFAAMLMPHQKATTADGSSILDRAVIEHNLLSASKLYNNI
TFEELGALLEIPAAKAEKIASQMITEGRMNGFIDQIDGIVHFETREALPTWDKQIQSLCF
QVNNLLEKISQTAPEWTAQAMEAQMAQ
Download sequence
Identical sequences U3IQD8
ENSAPLP00000009461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]