SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000009521 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000009521
Domain Number 1 Region: 648-951
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.16e-77
Family Protein kinases, catalytic subunit 0.0000000003
Further Details:      
 
Domain Number 2 Region: 78-248
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2e-72
Family Ephrin receptor ligand binding domain 0.000000277
Further Details:      
 
Domain Number 3 Region: 361-567
Classification Level Classification E-value
Superfamily Fibronectin type III 4.9e-39
Family Fibronectin type III 0.0000867
Further Details:      
 
Domain Number 4 Region: 947-1020
Classification Level Classification E-value
Superfamily SAM/Pointed domain 3.53e-22
Family SAM (sterile alpha motif) domain 0.00011
Further Details:      
 
Domain Number 5 Region: 306-347,395-418
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000659
Family Growth factor receptor domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000009521   Gene: ENSAPLG00000009704   Transcript: ENSAPLT00000010216
Sequence length 1023
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743359.1:706965:719429:-1 gene:ENSAPLG00000009704 transcript:ENSAPLT00000010216 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RGWQPVPVPPGRPSPCTSVGTPRSSCAPDSRAEIWSLSVPLPLLPPPLTPPVAVFRRNPS
NLGLQLQLLLSFLPLPPETLMDTKWVTSELAWTTHPETGWEEVSGYDEAMNPIRTYQVCN
VREANQNNWLRTKFIQRQDVQRVYVELKFTVRDCNSIPNIPGSCKETFNLFYYESDTDSA
SASSPFWMENPYIKVDTIAPDESFSKLESGRVNTKVRSFGPLSKNGFYLAFQDLGACMSL
ISVRAFYKKCSNTIAGFAIFPETLTGAEPTSLVIAPGTCIPNAVEVSVPLKLYCNGDGEW
MVPVGACTCAAGYEPTMKDTQCQACGPGTFKSKQGEGPCSPCPPGFFRADTDPADSACTS
VPSAPRSVISNVNETSLVLEWSEPQDAGGRDDLLYNVICKKCSVERRLCTRCDDNVEFVP
RQLGLTERRIYISNLMAHTQYTFEVQAVNGISSKSPFPPHFASVNITTNQAAPSAVPTMH
LHSSTGNSMTLSWTPPERPNGIILDYEIKYSEKQGQSDGIANTVTSQKNSVRLDGLKANA
RYMVQVRARTVAAGYGRYSLPTEFQTTAEDGSTGKTFQELPLIVGSATAGLLFVIVVVVI
AIVCFRKQRNSTDPEYTEKLQQYVTPGMKVYIDPFTYEDPNEAVREFAKEIDISCVKIEE
VIGAGEFGEVCRGRLKLPGRREIFVAIKTLKVGYTERQRRDFLSEASIMGQFDHPNIIHL
EGVVTKSRPVMIITEFMENCALDSFLRLNDGQFTVIQLVGMLRGIAAGMKYLSEMNYVHR
DLAARNILVNSNLVCKVSDFGLSRFLEDDPADPTYTSSLGGKIPIRWTAPEAIAYRKFTS
ASDVWSYGIVMWEVMSYGERPYWDMSNQDVINAVEQDYRLPPPMDCPTALHQLMLDCWST
VRDRNLRPKFAQIVNTLDKLIRNAASLKVIASVQSGVSQPLLDRTVPDYTTFTTVGDWLD
AIKMGRYKENFVNAGFASFDLVAQMTAEDLLRIGVTLAGHQKKILSSIQDMRLQMNQTLP
VQV
Download sequence
Identical sequences U3IQJ8
ENSAPLP00000009521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]