SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000009563 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000009563
Domain Number 1 Region: 48-218
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.82e-53
Family BCR-homology GTPase activation domain (BH-domain) 0.0000536
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000009563   Gene: ENSAPLG00000009856   Transcript: ENSAPLT00000010259
Sequence length 269
Comment pep:novel scaffold:BGI_duck_1.0:KB743518.1:707552:713095:-1 gene:ENSAPLG00000009856 transcript:ENSAPLT00000010259 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FQLDPQALQDKDWQRTVISMNGVEVKLSVKFTSREFSLKRMPSRKQTGVFGVKIAIVTKR
ERSKVPYIVRQCVEEIERRGMEEVGIYRVSGVATDIQALKAAFDVNNKDVSVMMSEMDVN
AIAGTLKLYFRELPEPLFTDELYPNFAEGIALSDPVAKESCMLNLLLSLPEPNLVTFLFL
LDHLKRVAERESINKMSLHNLATVFGPTLLRPSEKDSKIPANPTQPITMTDSWSLEVMSQ
VQVLLYFLQLETIPTPDSKRQSILFSTEV
Download sequence
Identical sequences U3IQP0
ENSAPLP00000009563

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]