SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000009584 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000009584
Domain Number 1 Region: 214-355
Classification Level Classification E-value
Superfamily PH domain-like 2.29e-40
Family Third domain of FERM 0.00000262
Further Details:      
 
Domain Number 2 Region: 105-213
Classification Level Classification E-value
Superfamily Second domain of FERM 3.01e-37
Family Second domain of FERM 0.00000221
Further Details:      
 
Domain Number 3 Region: 20-102
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.07e-24
Family First domain of FERM 0.0000142
Further Details:      
 
Domain Number 4 Region: 510-560
Classification Level Classification E-value
Superfamily Moesin tail domain 0.00000000275
Family Moesin tail domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000009584   Gene: ENSAPLG00000009847   Transcript: ENSAPLT00000010280
Sequence length 562
Comment pep:novel scaffold:BGI_duck_1.0:KB742489.1:1598719:1615274:-1 gene:ENSAPLG00000009847 transcript:ENSAPLT00000010280 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CPHKLKNMSIRGLKKKQPKTFKVKIITVDAEMEFSCEMKWKGKDLFDLVCRALGLRETWF
FGLQYTMKGMCTWLKMDKKVLDQEIPKEDPISFHFLAKFYPEKVEEELLQEITQHLFFLQ
VKKQILDEEIYCSPEATVLLASYAVQAKYGDYDPNFHEPGFLAHDELLPKRVLRQYQLTA
EMWEEKITAWYAEHRGIARDEAEMNYLKIAQDLEMYGVNYFPIANKNHTDLLLGVDAKGI
HIYSINNRFSPNKSFEWSAIRNISYSEKELTIKPLDKKAEVFKFFSSQLKVNKLILQLCI
GNHDLFMRRRKVDSIEIQQMKAQAREEKARKKMENQRLAREKQLREEAERAKEELERRLF
QLEDEARQANEALLRSQEAAELLAEKAQIAEEEAKLLAQNAAEAEQERQRLEITALKTKE
EKRLMEQKMREAELIAVKLVKESDRRAKEAEHLKKDLHEAREAERKAKQKLLDITRLNYP
YLQAKQHMVKYPQYLPTDTRDANFDKGSIKLDLKDVDLKRLSFEIERERLDYLEKSKKFE
DRLKELKSEIHALKLEEKQSGL
Download sequence
Identical sequences U3IQR1
ENSAPLP00000009584

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]