SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000009589 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000009589
Domain Number 1 Region: 338-582
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.65e-48
Family Plant O-methyltransferase, C-terminal domain 0.00062
Further Details:      
 
Domain Number 2 Region: 2-180
Classification Level Classification E-value
Superfamily ITPase-like 1.5e-44
Family Maf-like 0.0000311
Further Details:      
 
Domain Number 3 Region: 257-337
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000753
Family Plant O-methyltransferase, N-terminal domain 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000009589   Gene: ENSAPLG00000009849   Transcript: ENSAPLT00000010285
Sequence length 586
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742481.1:1428176:1454719:-1 gene:ENSAPLG00000009849 transcript:ENSAPLT00000010285 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLRFEVVPSWFKETLEKSSFAAPYEYAVETAKQKALEVANRMHVKHLRTPDIVIGADTIV
SVDEQILEKPVDKQDAYRMLSRLSGKEHSVFTGVAIIHCSSKVGNQLETEITDFYEETKV
KFSDLSEELLWEYIHSGEPMDKAGGYGIQALGGMLVEYVHGDFLNVVGFPLNHFCKKLAE
LYYPPPKHTVQHIKHDSIPSVDTFENLSDGESESSNFTEHKGAKNCENSSSVRTDSMVPL
GNQNGASESAAKLPSKIVDLMDGFKASKALFVASKLKVFDYLKTKGPLKAVDVANEVGTS
VCGTERLLDACVALGLLEKTSQGYSNTDSANTYLTSDGEYSLHGYIIHSNDHLWPLFTNL
ESAVREGSRQNHRAFGRKAEDLFKDYYHSQEVKQRFMAAMHSIAHLTARDVATAFDLSQF
KSTCDLGGCTGALAHELIQIYPNMKVTVFDLPEVIANISYFQPSEQCAAPVTFVSGDFFK
DNLPEADLYILSRILHDWPDERIHVLLSKISAVCKPGCGILLAEMVLDDEKKNRSTALLQ
SLNMLVQTEGKERSGPEYRGLLEQHGFANVKIKLTGNLLDVILCIK
Download sequence
Identical sequences U3IQR6
ENSAPLP00000009589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]