SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000009600 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000009600
Domain Number 1 Region: 889-1081
Classification Level Classification E-value
Superfamily Bet v1-like 3.16e-61
Family STAR domain 0.0000000146
Further Details:      
 
Domain Number 2 Region: 638-848
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.91e-44
Family BCR-homology GTPase activation domain (BH-domain) 0.00056
Further Details:      
 
Domain Number 3 Region: 23-97
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.2e-33
Family Variant SAM domain 0.0000489
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000009600   Gene: ENSAPLG00000009841   Transcript: ENSAPLT00000010296
Sequence length 1093
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742680.1:862407:984996:-1 gene:ENSAPLG00000009841 transcript:ENSAPLT00000010296 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYLRFDQTARRPPYRTSRILARHQLLTKIQQEIEAKEACDWLRAAGFPQYAQFYEDSQFP
IDIAAVKRDHDFLDKDLVEPLCRRLNTLNKCASMKLDVNFQRKKSEDSDEEDLCAISNKW
TFQRTSRRWSRVDDIDVLLHRSDRHGSSGDIKMKNTTSSESVLTDLSEPEVSSIHSESSG
GSDNRSQSGISSAARETCDCSGQHDVESTQLLDSTAVSTVLFPKDNLKNEKPTRTRAKTF
LKRMETLKAKGVHGKLKGSGRTGPLEISGPILQHEPKSLKDMHCVQIVNGDLQNMGQDSG
KRGLSFSAKSSSESSQSENSSSGVSTPCLKERKCHEANKRGGMYLEDIDVLSGAALRQVV
DQNRKNEFHSQENLVVHIPKDHKPGTFPKALSIESLSPTDTSNGVNWRTGSISLGKQNCS
TPKESGLMACCPKESRISIYDNVPGSHLYASTGDLLDLEKDVLFPHLDDILQHVNGLQEV
VDGWSKNVLPGLPVDDDRVRESPSLPFQSPTQITLDFEGNSVSDGRTTPSDMDRDGTSLN
ESEATGVRDRRDSGVGASLTRPSRRLRWHSFQISHRLSHSIASLHISNQSAAQLNLLQKF
SLLRLTAIMEKYSMSNKHGWTWSVPKFMKRMKVPDYKDKNVFGVPLIVHVQRTGQPLPQS
IQQALRYLRSNCLDQVGLFRKSGVKSRIQALRQMNESSPENVSYEDQSAYDVADMVKQFF
RDLPEPLLTSKLGETFLHIYQYVPKEQRLQAVQAAIMLMSDENREVLQTLLCFLSDVTSV
EENQMTPMNIAVCLAPSLFHLNIVKKESSPRVIQKKYATGKPDQKDLSENLAATQGLAHM
IMECNKLFEVPHEMVTQSRNSYIDAEVHSPTLDELGKQVDEEGGSYQTYLESLMQNLQKE
AKEKFKGWVTCSSMENTELAYKKVGDGNPLRLWKASVEVEAPPSVVLNRVLRERHLWDED
FLQWKVVESLDKQTEVYQYVLNSMAPHPVRDFVVLRTWRTDLPKGMCMLVAISVEHEEAP
PMGAVRAIVMDSQYLIEPCGSGKARLTHICRIDLKGHSPEWYNKGFGHLCAAEVARIRNS
FQPLIAEGPETKI
Download sequence
Identical sequences U3IQS7
XP_005013853.1.99704 ENSAPLP00000009600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]