SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000009619 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000009619
Domain Number 1 Region: 111-184
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.17e-26
Family P4 origin-binding domain-like 0.0000202
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000009619   Gene: ENSAPLG00000009912   Transcript: ENSAPLT00000010315
Sequence length 211
Comment pep:novel scaffold:BGI_duck_1.0:KB743712.1:17289:36481:1 gene:ENSAPLG00000009912 transcript:ENSAPLT00000010315 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RTTYPYTETQMYSQNTGGNYFDTQGSSAQVTTVVSSHSMVGTGGIQMGVTGGQLISSSGG
TYLIGNSMENSGHSVTHTMRTSPATIEMAIETLQKSDGLSTHRSSLLNSHLQWLLDNYET
AEGVSLPRSTLYNHYLRHCQEHKLDPVNAASFGKLIRSIFMGLRTRRLGTRGNSKYHYYG
IRVKPDSPLNRLQEDMQYMAMRQQPMQQKHR
Download sequence
Identical sequences U3IQU6
ENSAPLP00000009619

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]