SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000009637 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000009637
Domain Number 1 Region: 891-1082
Classification Level Classification E-value
Superfamily Bet v1-like 5.95e-58
Family STAR domain 0.000000271
Further Details:      
 
Domain Number 2 Region: 638-850
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.1e-48
Family BCR-homology GTPase activation domain (BH-domain) 0.00028
Further Details:      
 
Domain Number 3 Region: 10-80
Classification Level Classification E-value
Superfamily SAM/Pointed domain 3.08e-33
Family Variant SAM domain 0.0000426
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000009637   Gene: ENSAPLG00000009900   Transcript: ENSAPLT00000010333
Sequence length 1095
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742619.1:1406252:1430808:-1 gene:ENSAPLG00000009900 transcript:ENSAPLT00000010333 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVLRKPVQSIFPLPEIEAKEACDWLRAAGFPQYAQLYEDLLFPIDIALVKREHDFLDRDA
IEALCRRLNTLNKCAVMKLEISPHRKRSEDSDEDEPCAISGKWTFQRDSKRWSRLEEFDV
FPPKPDLNTSSPEAPHLTNAASRESVLTDLSERQEVASILSISSTSSHQPTLQSEASTTR
TNSVVSVCSSSNFVANDDSFSSLPSPRELNSFSFNTKANEKNTKSKTKSLLKRMESLKIK
SSHHGKNKAPSKLGLIISGPILQEGMDEDKLKQLNCVEISALNGNHISLPMVRKRSVSNS
TQTSSSSSQSETSSAVSTPSPVTRTRSLSAYNKRVGMYLEGFDPFNQSTFSDVMEQNFKN
RGSFAEDTVFFIPEDHKPGTFPKALSNGNFSPTESNASVNWRTGSFHGHGHLTLRRENSG
DSSKELSMGKRRNSASSVSSRLSIYDNVPGSILYSSTSDLADLENEDIFPELDDILYHVK
GMQRIVNQWSEKFSDEGDSDSALDSISPCPSSPKQIHLDVDNDRTTPSDLDSTGNSLNET
EEPSGMQDRRDSGVGASLTRSSRHRLRWHSFQSSHRPSLSSASLQINCQSVAQMNLLQKY
SLLKLTALLEKYTPSNKHGFSWAVPKFMKRIKVPDYKDRNVFGVPLQINVQRTGQPLPQS
IQQAMRYLRNHCLDQVGLFRKSGVKSRIQALRQMNESSADSVNYDGQSAYDVADMLKQFF
RDLPEPLMTNKLSETFLQIYQYVPKDQRLQAIKAAIMLLPDENREVLQILLYFLSDVTAA
VKENQMTPTNLAVCLAPSLFHLNTLKRENSSPRVMQRKPSLGKPDQKDLNENLAATQGLA
HMIAECKKLFQIPEEMSRGRNSYTEQDLRPLSLEELRGNSSTTEPSDYHCYLQDCVDDLL
KEMKEKFKGWVSCSTSEQAELAYKKACEGPPLRLWKTTIEIAATPEEVLNRLLKEQHLWD
EDLIDSKVIEPLDSQTDIYQYVQNSMAPHPARDFVVLRTWRTNFPKGACVLLATSVDHDR
APVAGVRVNVLLSRYLIEPCGSGKSKLTYMCRIDLRGHMPDWYTKSFGHLCASEVVKIRD
SFTHQSLESKEVKSR
Download sequence
Identical sequences U3IQW4
ENSAPLP00000009637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]