SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000009650 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000009650
Domain Number 1 Region: 55-526
Classification Level Classification E-value
Superfamily Sema domain 3.01e-126
Family Sema domain 0.0000254
Further Details:      
 
Domain Number 2 Region: 1367-1496,1692-1880
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.2e-51
Family p120GAP domain-like 0.037
Further Details:      
 
Domain Number 3 Region: 977-1054
Classification Level Classification E-value
Superfamily E set domains 5.74e-16
Family Other IPT/TIG domains 0.05
Further Details:      
 
Domain Number 4 Region: 1057-1159
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000451
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.069
Further Details:      
 
Domain Number 5 Region: 529-581
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000034
Family Plexin repeat 0.0021
Further Details:      
 
Domain Number 6 Region: 874-965
Classification Level Classification E-value
Superfamily E set domains 0.00000000000854
Family Other IPT/TIG domains 0.0075
Further Details:      
 
Domain Number 7 Region: 1156-1236
Classification Level Classification E-value
Superfamily E set domains 0.000000513
Family E-set domains of sugar-utilizing enzymes 0.037
Further Details:      
 
Domain Number 8 Region: 825-859
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000615
Family Plexin repeat 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000009650   Gene: ENSAPLG00000009851   Transcript: ENSAPLT00000010346
Sequence length 1911
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742896.1:22751:147319:-1 gene:ENSAPLG00000009851 transcript:ENSAPLT00000010346 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLGHRTRAGSTSFAFPRMDQRKIWPRVPDSDGWSVALLCLFLASLSRNASGSALFSTFHS
ENRDWTFNHLTVHQGTGAVYVGAINRVYKLSGNLTILVAHKTGPEEDNKSCYPPLIVQPC
SEILTLTNNVNKLLIIDYSENRLLACGSLYQGVCKLLRLDDLFILVEPSHKKEHYLSSVN
KTGTMYGVIVRSEGEDGKLFIGTAVDGKQDYFPTLSSRKLPRDPESSAMLDYELHSDFVS
SLIKIPSDTLALVSHFDIFYIYGFASGNFVYFLTTVQPETPEGVSINSASDLFYTSRIVR
LCKDDPKFHSYVSLPFGCVKGDTEYRLLQAAYLSKPGDVLARALNITAQEDVLFAIFSKG
QKQYHQPPDDSALCVFPIRTINAQIKDRLQSCYQGEGNLELNWLLGKDVQCTKAPVPIDD
NFCGLDINQPLGGSVPVDGVTLFTSSRDRMTSVASYVYNGYSVVFVGTKNGKLKKIRADG
PPHGGIQYEMVTVFKDGSPVLRDMAFSVDHKYLYVMSERQVSRVPVESCEQYTTCGECLS
SGDPHCGWCTLHHMCSPRDSCERAAEPYRFADSIGQCMSITVQPSSISVSQHSLPLSLLV
SDAPDLAAGVTCLFGNLTEVEGQVSGSRVVCVSPAGSSLPAPPALHHWFGVVLQLKSRET
GRTFVSTEFKFYNCSAHQLCLSCVNSAFRCHWCKYRNLCTHDPTTCSFQEGRINVSEDCP
QLFPTEEILIPVGEVKPITLKARNLPQPQSGQRGYECVLSIQGIIHRVPALRFNSSSVQC
QNSSYLYDGMDISNLAVDFAVVWNGNFVIDNPEDLKVHLYKCAAQRESCGLCLKADPKFE
CGWCSGEAKCTLRPHCSPPAAQPWLDWSSRNVKCSNPRITEILTVSGPPEGGTRVTIRGV
NLGLDFSEIAHGVQVAGVPCAPLPEQYVVAEQIVCEMGQALPGISSGPVLLCIGECKPEF
TARSAQQYSFVTPAVSFLTPSRGPESGGTLVTIAGHHLGAGSRVSVLLGNQSCTFQGRST
NEIVCMSAPSAHGLGPVHVSVDRAQLEQTLLFEYIDDPKVQHIEPEWSIASGHTPLTVTG
SNLDVIQEPRIRVKHNGKESVNVCKAVNATALACLAPALAPEHRPGLDAVERPDEFGFIF
NNVQSLLVYNDTKFIYYPNPTFELLSPTGVLEQKPGSPIILKGKNLCPPAPGGAKLNYTV
LIGETPCAVTVSETQLLCEPPNLTGQHKVTVRVGGIVFSPGSVSISSDSLLTLPAIVSIA
AGGSLLLIIVIIVLIAYKRKSRENDLTLKRLQMQMDNLESRVALECKEAFAELQTDINEL
TSDLDRSGIPYLDYRTYAMRVLFPGIEDHPVLRELEVQGNGQQSVEKALKLFAQLINNKV
FLLTFIRTLELQRSFSMRDRGNVASLIMTGLQGRLEYATDVLKQLLSDLIEKNLENKNHP
KLLLRRTESVAEKMLTNWFAFLLHKFLKECAGEPLFMLYCAIKQQMEKGPIDAITGEARY
SLSEDKLIRQQIEYKTLILNCVNPDNENSPEIPVKVLNCDTITQVKEKILDAVYKNVPYS
QRPRAVDMDLEWRQGRIARVVLQDEDITTKIEGDWKRLNTLMHYQVSDRSVVALVPKQTS
SYNIPASASISRTSISRYDSTFRYTGSPDSLRSRAPMITPDLESGVKVWHLVKNHDHGDQ
KEGDRGSKMVSEIYLTRLLATKGTLQKFVDDLFETLFSTVHRGSALPLAIKYMFDFLDEQ
ADKHGIHDTDVRHTWKSNCLPLRFWVNVIKNPQFVFDIHKGSITDACLSVVAQTFMDSCS
TSEHRLGKDSPSNKLLYAKDIPSYKSWVERYYADIAKLPAISDQDMNAYLAEQSRLHSAE
FNMLSALNEIYSYVSKYSEELIGALEQDEQARRQRLAYKVEQLIGAMSIES
Download sequence
Identical sequences U3IQX7
ENSAPLP00000009650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]