SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000009675 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000009675
Domain Number 1 Region: 652-1001
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.73e-91
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.000000437
Further Details:      
 
Domain Number 2 Region: 475-645
Classification Level Classification E-value
Superfamily ARM repeat 1.35e-45
Family Phoshoinositide 3-kinase (PI3K) helical domain 0.00067
Further Details:      
 
Domain Number 3 Region: 322-458
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.03e-20
Family PLC-like (P variant) 0.033
Further Details:      
 
Domain Number 4 Region: 1042-1146
Classification Level Classification E-value
Superfamily PX domain 2.88e-18
Family PX domain 0.0031
Further Details:      
 
Domain Number 5 Region: 1165-1271
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000000000062
Family Synaptotagmin-like (S variant) 0.014
Further Details:      
 
Domain Number 6 Region: 6-148
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000047
Family Ras-binding domain, RBD 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000009675   Gene: ENSAPLG00000009943   Transcript: ENSAPLT00000010372
Sequence length 1274
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742887.1:1598054:1795830:-1 gene:ENSAPLG00000009943 transcript:ENSAPLT00000010372 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GWSIQLVEANQGSNENTVAFCNAVEEIRNAYPAYDLKTNTGKIWSVTTKFPDHILGESRF
RISIWTDSSPYPLLLTKHAGCITHNLIAEILCCTNQYPVQEECLLSVCGSDEFLQNNCTL
GSHESLRKSTTCIQLRLHVTTNLKQSLARTYEDDQRQFSVNQLLEYTCAWRLTRLNLVSV
IMKYRDQVEHLLQNEMDKTSKKLFLFFLCYQQHKVDNVIEVAKAICSILCFVETRDITDA
VKKLLAVPLVKAQNTLQCVETPDKALMEAAVTELSMAISRLIHVYSSSFETDFQLASIPK
NPSCADISLDSQLSFTIYAAHNIPEVWVNSYKVFSFSCSLTYAGKTICQVKICKRIPVKR
SFFFLAEWNEKINFPLRIKALPRETILIIKLLGVNSASKNTEVLAWTCSPLYPKERLIHG
TVLLSMKLDSILPASMITPGICSTDIPTSVTLQIDFPETNLEFIKPEPEEKKDLEEPTKE
CLKHIARLSQAQSLLLLSEQQRRILWFYRYYCNNQNCSLPLVLGSAPSWDRTTVSEMYSV
MRRWRFSNPLEAFGLLTFSFPDKDIRRTAVQQIENLSNDELLEYLPQLVQVLKFEWSLES
PLVKLLLHRSLQSTQIAHQLYWLLKNAQNEIHFKIWYRKLLAAFQFSAGKALNNEFSKEG
KLLRILEDIAEKVKAASDQKRKEVLKMELSRLQQFFQEVKVCRLPLNPALVVQGIEADSC
SYFTSNAFPLKISFINANAPSGNINIIFKIGDDLRQDMLVLQIIRLMDNIWLQEGLDMQM
IIYKCLSTGKDQGLVQMVPDATTLAKIHRKSGLIGPLKENTIKKWFRHHHQLESSYQEAI
RNFFYSCAGWCVVTFILGICDRHNDNIMLTNAGHMFHIDFGKFLGHAQTFGSIRRDRASF
IFTSEMEYFITEGGKNPQRFQEFVELCCRAYNIVRKHSQLLLNLLEMMLHAGLPELKSIQ
DLKYVYDNLRPQDSDLQATSYFTRKIKESLECFPVKLNNLIHTLAQMSVTGSAKPPAPET
VPQEWMMLNTEKSIARATILGFNKNPIQLYLVQVVQTCNVVTFVEKSFDQFSKLHSQLQK
QFPSEALPEFPHSWHIPFADLEHKRVKDLNLYLKQLLSGSIKMANNELVLSFFLNWTKKT
FTETSSSVTLGPQSTDHKPGVQLVISYEGTRLTIMLKHMRNIRLPDGSAPSAHAEFYLLP
DPDEVSRRKTRTVPKSTDPTYNEIVVYNKVMELKSHILKLVVKSKGTFVGAVNIQLSSVQ
LNEEKWYPLGNSVI
Download sequence
Identical sequences U3IR02
ENSAPLP00000009675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]