SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000009790 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000009790
Domain Number 1 Region: 335-409
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.01e-19
Family SAM (sterile alpha motif) domain 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000009790   Gene: ENSAPLG00000010070   Transcript: ENSAPLT00000010488
Sequence length 411
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742848.1:453287:486550:-1 gene:ENSAPLG00000010070 transcript:ENSAPLT00000010488 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSPRIAGRKRGRPPLQPAPIKVAVHNLFSAPAGALPLVKIPKKRGRKPGHKLKSRVLMT
PLAVSPPRSTPEPDVSSIPQDAATIPNSAAPQALTVCIYVNKQASLGPYLNRKKVQQLPE
HFGPERPSTVLQQAVQACIDCALQQKAVFSLIKPGYGGEMVPVSASFEGKQHLLSLLAVN
SIGYVLRFLKKLCRSLLCDNLFSNQPFQQYSAAPGTPEVYENRRMEAACWAETVVPEDYL
VDPVHMKRYSVDPADPAFSCVGSMYATRQSPADGRAAGGSSSSCSHRPTQTSSGGSSSTG
LRHQTSSPTRNGTYPEGNRSATASSPSPEQDSARPSSKNPLTWTVDDVVWFVKDADPHAL
GPHVELFRKHEIDGNALLLLKSDMIMKYLGLKLGPALKLCYHIDKLKQTKF
Download sequence
Identical sequences U3IRB7
ENSAPLP00000009790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]