SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000009820 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000009820
Domain Number 1 Region: 14-189
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.06e-47
Family DBL homology domain (DH-domain) 0.0000378
Further Details:      
 
Domain Number 2 Region: 175-320
Classification Level Classification E-value
Superfamily PH domain-like 2.01e-34
Family Pleckstrin-homology domain (PH domain) 0.00057
Further Details:      
 
Domain Number 3 Region: 435-565
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.47e-30
Family DEP domain 0.0012
Further Details:      
 
Domain Number 4 Region: 337-452
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 8.71e-29
Family DEP domain 0.0032
Further Details:      
 
Domain Number 5 Region: 555-634
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000213
Family PDZ domain 0.031
Further Details:      
 
Domain Number 6 Region: 643-700
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000133
Family PDZ domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000009820   Gene: ENSAPLG00000010034   Transcript: ENSAPLT00000010521
Sequence length 1602
Comment pep:novel scaffold:BGI_duck_1.0:KB742845.1:1405942:1510716:-1 gene:ENSAPLG00000010034 transcript:ENSAPLT00000010521 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AFLHRIRQNAVDKAEKYITEENVKVLFSNIEDILGVHKEFLAALEFSLQPEPQSQHELGN
VFLKFKDKFFVYEEYCSNHEKALRLLMELNKIPTVRAFLLSCMLLGGRKTTDIPLEGYLL
TPIQRICKYPLLLKKELAKRTPSKHPDHPAVQNALQAMKTVCTNINETKRQMEKLEALEQ
LQSHIEGWEGSNLTDICTQLLLQGTLLKISAGNIQERMFFLFDNLLVYCKRKSRVAGKKA
SKRTKSINGSLYIFRGRINTEVMEVENVEDGTADYHSNGYTVTNGWKIHNTAKNKWFVCM
AKTAEDKQKWLDAIIKEREQRESLKLGMERDAYVMIAEKGEKLYQMMMSKKVNLIKDRRR
KLSTVPKCFLGNEFVSWLTEIGEISKPEEGVNLGQALLENGIIHHVSDKHQFKNEQVMYR
FRYDDGTYKPRSELEDIMSKGVRLYCRLHCLYTPVVKDRDYHLKTYKSVIPASKLVDWLI
AQGDCQTREEAVALGVGLCNNGFMHHVLEKSEFKDESLYFRFYADEEMEGTSSKSKQLRN
DFKLVENILGKRLLILPEEDDYGFDIEEKNKAIVVKSVRRGSSAEMAGLQIGRKIYSINE
DLVFLRPFLEVETILNQSFCSRRPLRLLVATKSKEIIKIPDCPEALCFQIRGAAPPYVHA
VGRGSEAAAVGLHPGQCILKVNGNNASHGNYMEVLEHFTAYRMRQQEVLGLYQWVYRTHE
DAEEDRVQQAASSAYLNGSHPGSSKEDSSLEGGEEVDPLQNSQQESAQIQQTIISSLITG
EETPLISLTVDNTHLEHGVVYEYVSSAGIKSFVLEKIVEPKGCFSLTAKILEAFAAEDSH
FVRNCKRLISLSSAVATMPQYEFRQICDTKLESISRRLANYQEFADGLKTKVSPAFKQAV
MEPHSLNSMDFCPTNCHINLMEVSYPKNTTSAGRSFSIRIGRKPSIIGLDPEQVGTINPV
SYTQHCITTMAAPSWRCLTPEDGDLDGSFGQQNGGTSQEERGLSFLLKQEDREIQDSYLH
LFNKLDIAVKEMKQYVIQINKLLSTITEPTEGGACEPPSNEETSPPSLGTEESDPDKAEH
GGIKKVCFKVSEEDQEDSGHDTMSFRDSYSECNSNRDSVLSYTSVRSNSSYLGSDEMGSG
DELPSDMRIPLDKQDKLHGCLEHLFNQVDAINALLKGSAITKAFEETKHFPMDHSLQEFK
QKEETTVRCRNNIQASIQEDPWNLPLRIKNLVEIIQKHVEDGKNQLLLALLKCTDTELQL
RRDSIFCQSLVAAICTFSEQLLAALNYRYNNNGEYEESSRDASRKWLEQIAATGVLLNYQ
SLLSPTVKEERTMLEDIQVTLTELDKVAFYFKQMDESLVANTHVFYHIEGSRQSLKVIFY
LDSYYFSKLPSRFQNGGSLKLHTVLFTKALESMEGQLQPAGSPLEELPQQINGLSLEKVQ
QYYRKLRTFYLERSNLPTDSNTTAVKIDQLIRPINAMDELCRLMKSFINTKPTQSGYSSS
NISGAGLLPISSELCYRLGACQITMCGTGMQRSTLSVSLEQAAILARSHGLLPKCIMQAT
DIMRKQGPRVEISAKNLKVMDQMPPCAPRLYRLCQPPTDGDL
Download sequence
Identical sequences U3IRE7
ENSAPLP00000009820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]