SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000009850 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000009850
Domain Number 1 Region: 1-223
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.31e-54
Family BAR domain 0.0015
Further Details:      
 
Domain Number 2 Region: 233-427
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.69e-51
Family BCR-homology GTPase activation domain (BH-domain) 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000009850   Gene: ENSAPLG00000010084   Transcript: ENSAPLT00000010551
Sequence length 863
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB744448.1:62163:86272:-1 gene:ENSAPLG00000010084 transcript:ENSAPLT00000010551 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RAEKTEVLSEDLLQIERRLDTVRSVCHIAQKRLIACFQGQHGTDSDKRHKKLPLTALAQN
MQEGSVQLSDETLLGKMLDTCGDAENKLAMELSQHEVQIEREILEPLSVLTEMEIPNIQK
QRKQLAKLVLDWDSARGRYNQAHKTSGTNFQMHPSKIDSLKEEMDEAGNKVEQCKDQLAA
DMYSFVSKEGEYARFFVMLLEAQADYHRKALTVIEKVLPEIQAHQDKWTEKPAFGTPLEE
HLKRSGREIAVPIEACVMMLLETGMREEGLFRIAAGASKLKKLKAALDCSTSQLDEFYSD
PHAVAGALKSYLRELPEPLMTYSLYEEWTQAANIQDQDKKLQELWKICNRLPKHYHANFS
RYLIKFLAKLAQNSDVNKMTPSNVAIVLGPNLLWAKNEGSLAEMAAATSVHVVAIIEPII
QHADWFFPGDQDFNVSGAFVAVPPVNSNHLSHTGNEYDSGTLERKRPVSMAVMEGDLLKK
ESFGVKVMDFQANPRRCGTINRKHTSPAFQPPLPPTEAGVLAQSGAEQHPQAAVAETSPV
GAGFALSAGTAEQLQSQGNEDVSTSKSKDNASSATPPPVRNGGQANIAQNQSASSTNQLS
VNQPQNAAGPSPHSMRRAVKKPAPAPPKPANPPPGQPASQSSASAAQPPSISPKPPARSS
SPPAQHANQGAAQPSSSQVSAPRRYSSSLSPIQAPSHPPPQPPTQATPPLQPKSNSQASP
PAAASSEHGPEQPCYTPPQTPTPPDTPPLGKHSTSSPSSQSSTQETSQSHSPPHSGTLPR
PRPVPKPRNRPSVPPPPHPPSQLAGDGIIANPTQTASKIVTDSNSSIQEPLQNASSELLT
ETASKELHNHLALDVDDTESTAL
Download sequence
Identical sequences U3IRH7
ENSAPLP00000009850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]