SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000010093 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000010093
Domain Number 1 Region: 200-415
Classification Level Classification E-value
Superfamily SMAD/FHA domain 1.06e-55
Family Interferon regulatory factor 3 (IRF3), transactivation domain 0.006
Further Details:      
 
Domain Number 2 Region: 30-108
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 6.62e-18
Family Interferon regulatory factor 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000010093   Gene: ENSAPLG00000010348   Transcript: ENSAPLT00000010799
Sequence length 423
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742851.1:63392:69232:1 gene:ENSAPLG00000010348 transcript:ENSAPLT00000010799 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCDRNGGRRLRQWRLPQEFPSFCPHFHLLLCLLWHHPQCQGISQQLEMGYFAAWAVFKGK
FKEGDKAEPATWKTRLRCALNKSPDFEEVTDRSQLDISEPYKVYRIVPEEEQKCKSGVGT
GSGLADVTDMDCSPSAIDDLMKEPPCVDEYLGIIKRSPSPPQETCRNPPIPDWWVQQPNP
TLPLMNGYTGYEQHHSGYSQMVINFFYGGKLVGHITTSYPEGCRISLSQPSGPNEKLYAP
DALEHVRFPSAEAIQNDRQKQITKKLFGHLERGVLLHSNKQGIFIKRLCQGRVFWSGNTM
VYKDRPNKLDRDEVVKIFDTNLFFRDLQQYYNNQGRYPDSRVTLCFGEEFPDPTLRCKLI
LVQVEQLFLRQVVEDTEKAYSSSSSPLVPAANETQHEQVYRIFQDICGPHQRPLFRENQQ
IAV
Download sequence
Identical sequences U3IS70
ENSAPLP00000010093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]