SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000010103 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000010103
Domain Number 1 Region: 361-464
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 7.62e-47
Family ets domain 0.0000579
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000010103   Gene: ENSAPLG00000010344   Transcript: ENSAPLT00000010810
Sequence length 505
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB744591.1:33340:43087:1 gene:ENSAPLG00000010344 transcript:ENSAPLT00000010810 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XDGFCHQQVPFMGPGKSCTEEGRGRLGSDRKRKFLETDLAHDSEELFQDLSQLQEAWLAE
AQVPDDEQFVPDFQSDNLVLHAPPPAKIKRELHSPSSELSACSHEQALCASYGDKCLYNC
CAYDRKPPKGGQQLAPARSSAPGDLRAMRGAGRDPSGSAIPARGLGFTQEGQGDAGRKWS
NPSPSAGGDLVTKPNGARRPRKDRARGDRLSRCWAGQGTRQQHPLGIVPYPHGSTEPGRR
APVPLAENSAPAAPPALVRFQRQMSEPCHPFPPQPAPGHSFQSPMGIKQEPRDYCIDSEV
PNCQSSYMRGGVFPSSHDGFSYEKDTRLYFDDTCVVPERLEGKVKQEPTLYREGPPYQRR
GSLQLWQFLVTLLDDPANAHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYDKLSRS
LRYYYEKGIMQKVAGERYVYKFVCDPDALFSMAYPDNQRPFLKAEPDCHVNEEDTLPLTH
FEDSPAYLLEVDHCGGLPYAEGFAY
Download sequence
Identical sequences U3IS80
ENSAPLP00000010103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]