SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000010184 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000010184
Domain Number 1 Region: 102-346
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 3.09e-49
Family Plant O-methyltransferase, C-terminal domain 0.00078
Further Details:      
 
Domain Number 2 Region: 7-99
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000138
Family Plant O-methyltransferase, N-terminal domain 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000010184   Gene: ENSAPLG00000010447   Transcript: ENSAPLT00000010893
Sequence length 353
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742481.1:1554023:1560820:1 gene:ENSAPLG00000010447 transcript:ENSAPLT00000010893 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRKMGSTEDLDYPQIILQYNNGFLVSKVMFTACELGVFDLLLESGDPLSLDVIAARLGTS
TTGMERLLDACVGLKLLSVELTQKGALYRNTEISNIYLTKSSPKSQYHIMMYYSNTVYLC
WHYLTDAVREGRNQYERAFGVSSKDPFGAMYRSEEEMLKFLAGQNSIWGICGKDVLTAFD
LSSFTRIYDLGAPSQGGGGALARECVSLYPNCTVTIYDLPKVVQVAKDRFIPPEEQRIAF
HEGDFFKDSIPEADLYILSKILHDWDDDKCGQLLAKVHQACRPGGGVLLVESLLKEDRSG
PIETQLYSMNMLVQTEGKERTPAEYSKLLVAAGFREVQVKRTGKLYDAILGRK
Download sequence
Identical sequences U3ISG1
ENSAPLP00000010184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]