SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000010216 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000010216
Domain Number 1 Region: 7-94
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.2e-22
Family Ubiquitin-related 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000010216   Gene: ENSAPLG00000010474   Transcript: ENSAPLT00000010925
Sequence length 406
Comment pep:novel scaffold:BGI_duck_1.0:KB742702.1:515868:536113:1 gene:ENSAPLG00000010474 transcript:ENSAPLT00000010925 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQGVVGPPVTLIIKAPNQKYTDQTISCFLDWTVGRLKSHLSKVYPSKPSTKDQRLVYSG
RLLPDHLQLKDVLRKQDEYHMVHLVCTSRTPPSSPKPSTSRGDHGASTSSSSSNMDRSGS
TAASSNQEASSTSSNTSADGVRHRNLPQAQSNPIPSHQFPYLMQGNIGNQFPGQGVPAGG
LPMYPAFSPLQMIWWQQMYARQYYMQYQAAVSAQVTSSTESVRSSVAQAVNSQHAPANEP
AAVPNVAVRENRPVNPNVQMNAQGGPVVNEEDFNRDWLDWMYTFSRAAILLSIVYFYSSF
SRFVMVMGAMLLVYLHQAGWFPFRQEGGQQQAANNVEGNRDAQNANNPDLEEMERLMDDG
IDEDSGEDAGEDANIEHQPGFMASAWSFITTFFTSLIPEGPPQVGN
Download sequence
Identical sequences R0LXQ7
XP_005014287.1.99704 ENSAPLP00000010216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]