SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000010266 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000010266
Domain Number 1 Region: 600-662
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000275
Family SAM (sterile alpha motif) domain 0.012
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000010266
Domain Number - Region: 289-322
Classification Level Classification E-value
Superfamily WWE domain 0.00589
Family WWE domain 0.012
Further Details:      
 
Domain Number - Region: 201-273
Classification Level Classification E-value
Superfamily WWE domain 0.0101
Family WWE domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000010266   Gene: ENSAPLG00000010500   Transcript: ENSAPLT00000010976
Sequence length 959
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743226.1:1035197:1050448:1 gene:ENSAPLG00000010500 transcript:ENSAPLT00000010976 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVVFADDSADVGEEDSFLGQTTASPNPPQTFNYFSQVPSSSDPFGSIGQPPLTTVAPPAG
APAFSRPPTSLPLGSGPQDGQNTFSPHVPKSQASYGTPPTSQGGMAAYQTPQQSCPPPNV
SALPHGASPQGYNNPYRHTTLSSRANPYLTPPQLQQSPPPGQAAHPPSSVPPVQMYQTPP
GALAQFPQPQSQLPAPRPSGPLVPAPPVLLQNQYEPVQPHWFYCKEVEDKQVWMPFSILD
SAKLEEVYNSVQPDPESVVLSTDGGRYDVYLYDRMRKAVYWDEEPSEVRRCMWFYKGDKD
SRFIPYTEDFSDKLEAEYKRAVTTNQWHRRLEFPNGETIVMHNPKVIVQFQPSATPDEWG
TSQDGQARPRVVKRGIDDDHDDIPDGEMAQIDHLVFMVHGIGPVCDLRFRSIVECVDDFR
TVSLKLLQTHFKKSLEERKVSRVEFLPVHWHSSLHGDATGVDRNIKKITLPSIGRLRHFT
NETLLDILFYNSPTYCQTIVDKVGMEMNRLYALFMSRNPDFKGGVSVAGHSLGSLVLFDI
LSNQKDLASSVNTGAFSGVNGTVKDVAIHDKQMAEDTSSLGSSITTSGDDLCEPDIDDDV
PTLQKTLEMLSLSDYASTFEKERIDMESLLMCTIDDLKEMGIPLGPRKKIANFVKDRAAK
QEQKKAAAEKKAVLAATLQTQEASQKAKETVTSISPSESGQQHSKRRLPFGASVSSVNID
YEYFEVGTGQVSVVYNALDFEPDIFFALGSPIGVFLTVRGLEKIDENYRLPTCKGFFNIY
HPLDPVAYRLEPMIIEDLDLKPVLIPHHKGRKRLHLELKDSLSRMGSDLKQGFISSLKSA
WQTLNEFARAHTSSTQLQAELEKVANQIKEEEEKQVVEAEKITESPEPPKDEDFSVKVGM
LNGGRRIDYVLQEKPIESFNEYLFALQSHLCYWASEDTALLFLKEIYRTMNINPEQPQH
Download sequence
Identical sequences U3ISP3
ENSAPLP00000010266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]