SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000010284 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000010284
Domain Number 1 Region: 30-135
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.58e-34
Family Ras-binding domain, RBD 0.00069
Further Details:      
 
Domain Number 2 Region: 138-227
Classification Level Classification E-value
Superfamily Ras GEF 3.4e-22
Family Ras GEF 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000010284   Gene: ENSAPLG00000010572   Transcript: ENSAPLT00000010995
Sequence length 228
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB752187.1:30:1105:-1 gene:ENSAPLG00000010572 transcript:ENSAPLT00000010995 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RVADETPPPSKQVKPLFRHFRRIDSCLQTRVAFRGSDEIFCRVYMPDHSYVTIRSRLSAS
VQDILASVTEKLQYSEEQGAREDALVLVTVASSGEKAVLQPSEECVFTTLGINSHLFACT
RDAFDSLVPLPEEIPVVPGDTEIHRVEPEDIANHLTAFHWELFRCIHELEFVDYVFHGER
GRRETANLELLLQRCSEGQHWVGTELLLCESLGKRAHLLKKLIKIAAM
Download sequence
Identical sequences U3ISR1
ENSAPLP00000010284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]