SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000010304 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000010304
Domain Number 1 Region: 44-793
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.49e-276
Family Motor proteins 0.000000000114
Further Details:      
 
Domain Number 2 Region: 1245-1348
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.36e-17
Family Ras-binding domain, RBD 0.063
Further Details:      
 
Domain Number 3 Region: 1340-1433
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000000183
Family Second domain of FERM 0.0057
Further Details:      
 
Domain Number 4 Region: 1854-1959
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000139
Family UBX domain 0.079
Further Details:      
 
Domain Number 5 Region: 1580-1616
Classification Level Classification E-value
Superfamily SH3-domain 0.0000951
Family SH3-domain 0.0034
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000010304
Domain Number - Region: 798-855
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0236
Family Motor proteins 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000010304   Gene: ENSAPLG00000010464   Transcript: ENSAPLT00000011016
Sequence length 1974
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB744955.1:438537:481735:-1 gene:ENSAPLG00000010464 transcript:ENSAPLT00000011016 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LYYLQVGDHVWLETQTSSEFNVPIGAVVKDSDSGRILLEDDEGKEHWIMAQNMHMVRPMH
PSSVQGVEDMIRLGDLHEAGMVHNLLIRHQQHKIYTYTGSILVAVNPYQLLPLYTVDYIR
LYCNKRIGELPPHVFAIADNCYFNMKRNKRDQCCVISGESGAGKTESTKLILQFLAAVSG
QHSWIEQQILEANPILEAFGNAKTVRNDNSSRFGKYIDIRFNRSGVIEGAQIEQFLLEKS
RVCRQAPEERNYHIFYCMLMGMNLEQKKMLNLGTASEYTYLTMGNCTSCDGRNDAKEYAH
IRSAMKILMFSDSEHWDISKLLAAILHLGNVEFEAAVYDNLDCSDVMDSPHFSIATKLLE
VDSSELQNSLTNLSIIVRGESVSRPLNVAQAADGRDAFVKGIYGRIFLWIVNKINSAISN
PTSEKPKNTHQSIGLLDIFGFENFSNNSFEQLCINIVNEHLQQFFVHHVFKLEQEEYLAE
HIAWNNIEFPDNHQALEIIALKPMNIISLIDEESKFPKGTDATMLIKINSLHGKSKVYIP
PKSDHDTKFGINHFAGAVFYESKGFLEKNRDTLSTNVMQVVHSSKNKFLRQIFQQYCVSK
GLDTTKRVSTLGGQFKQSLEKLMKILGQCQPYFIRCIKPNDYKKPLLFDRELCIKQLRYS
GMMETIQIRKAGYPIRYTFEEFFDRYRVLLPWSVQQQLKNDARQCCIGISEAVLGKDESW
QAGETKIFLKDHHDTVLELQRQKILTDKVLLIQKVMRGFKDRKQFLKQRKSAVAIQAAWR
GYCCRKNFRMIMLGFGRLQALYRSRQLAKQYETTRARVIKFQAACRGYLIRQKIGTWKKA
VCLIQAQCKGRVCLPNFAKDEERYKNRVLKEATRFEENSKTQSCKLTCKDDLEMGQVMLN
QILCLKKHLSTLEINEEEERQRRTDVFASRPANDEVISDQEMVDKIFGFLPSMIGGQEGQ
APLGFEDLETKPHKLEEVDLDTIPMSVELEEETDGLEEYTFPKFAATYFQGSSTHTHIRR
PLRHPLLYHDDKDNVLASLVVWVIILRFMGDLPEPAMFARNVTKNSSVMTQIYDTLGRKN
QVQFKSDSPGMRESRKDNKISKGISSLKLKRSSKLTGKVTDQLRSGEEGFQEDTSISERP
MSNLEKVHFIIGNAILRPAIRDEIYCQICKQLSENSNRNSYARGWILLSLCLGCFPPSET
FLKYLLNFIHKGPSGYAPYCAERLRRTYVNGARTEPPSWLELQATKQKKPIVFNVTLMNG
QSITVPADSASIAKEICQFIADKTKLKDVFGFSLYIAVFDKVWSLGGGRDHVLDAISQCE
QLAKEKGTHERNAPWRLYFRKEIFTPWHNSQEDPISTDLIYHQVIRGIRFGEYRCEKEED
LVEIGAKYCYIQFGDSIHNELVQKALHDCIPVKQLKSKPLEKWVSLITYAHAKAPYTQDR
LSRQTVKEQLVDFARFQWPLLFSRFFEVTKFSGPSLPKNHFILAVNWKGICFLDESEKQI
LDLTFPEITGIHTNRAVKSFGQSCTLITLRAEEFVLTSVNSIVIAELVVMFLEGLKKRSR
FAVAMNEKRPQVFSEDPAILSFKKGDLLILTEDKRLDASSGWIYAQNERTGKTGNVFLEE
IYIVPSLTKPSSQVLSLLMMSPDQRRTASQNSYMDQPDEEDLKVKPYTLEEFSYEHFRTP
EKESISKAVLQKSRGRNQLWAHSKEPLKQPLLKKACTDPDLRDLACQAFKHLPIMKFMGD
YPSKQAHSSVEVTDQIFVAAIQEEVLRDEIYCQIMKQLTENRNRYSVTKGWQLLWLCTGL
FPPSKSLLKHAQKFVETRKKEPLAMECSRRIQTVMRNGSRKWAPHPVEVEAILQNNTKIS
HKICFPNETEETFDVGTNTKIRTLCQNIASKLQLSSWEGFSLFVKIADKVISQNEADYFF
DSLRQVTDWNRRNKPVKDGAAMSVAYEVYFMRKLWLNVTPGKDLKADSIFHYHQ
Download sequence
Identical sequences U3IST1
ENSAPLP00000010304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]