SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000010311 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000010311
Domain Number 1 Region: 450-534
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.09e-29
Family Forkhead DNA-binding domain 0.0000152
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000010311
Domain Number - Region: 294-319
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.022
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000010311   Gene: ENSAPLG00000010568   Transcript: ENSAPLT00000011023
Sequence length 658
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743493.1:294524:329515:-1 gene:ENSAPLG00000010568 transcript:ENSAPLT00000011023 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMVESASETIRSTPSGQNGVSSLTNQPEGAASGEANGEMSPVELLHFQQQQALQVARQFL
LQQATGLSSPSSNEGKQPAVQVPVSVSVAMMSPQMITPQQMQQILSPPQLQALLQQQQAI
MLQQLQEYYKKQQEQLHLQLLTQQQAGKQQPKEQPLGNKQLAFQQQLLQMQQLQQQHLLN
LQRQGLVSLPPGQGTVPLQTLPQGFPPSAVCPSDLQQLWKEVTAAQPVEDSIKQEGLDLT
TNTSNSTSFSAAKVSPPISHHPLPNGQSTMHTPRRDSSSHEETPGSHPLYGHGECKWPGC
ETLCEDLGQFVKHLNTEHALDDRSTAQCRVQMQVVQQLEIQIAKESERLQAMMAHLHMRP
SEPKPFSQPLNLVSSATLSKSTSDTFPDGLPHPPTSATAPITPLRQGPSVISSSTLHNVG
PIRRRNSEKFCTPISSELAQNHEFYKNADVRPPFTYASLIRQAILETPDRQLTLNEIYNW
FTRMFAYFRRNTATWKNAVRHNLSLHKCFVRVENVKGAVWTVDEHEYQKRRPPKMTGWVR
VWVSSPGARSHPSSRFLLQAALAQSSFPLLNSPTMINTSSASGMLHVGQALEQVNSNGSN
SPRLSPQQYSSHPVHVKEEPAEAEDDSRPVSLLATTNQNVTIADDRDLEEELPVEDLS
Download sequence
Identical sequences U3IST8
ENSAPLP00000010311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]