SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000010319 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000010319
Domain Number 1 Region: 81-173
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.53e-20
Family Ubiquitin-related 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000010319   Gene: ENSAPLG00000010596   Transcript: ENSAPLT00000011031
Sequence length 181
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB744431.1:8732:9463:1 gene:ENSAPLG00000010596 transcript:ENSAPLT00000011031 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XRSKRDEFWDTAPAFEGRKEIWDALKAAAYAVEANDHSLAQAILDGASITLPHGSLTECY
DELGNRYQLPVYSRSPPVNLILERGEEEAAEAAEPLPSARREFALKVRLSTGKDLRLSAS
MGDTIGQLKKQLQAQEGIELAWQRWFFSGKLLTDRTRLQETKIQKDFVVQVIVNQPLPPR
N
Download sequence
Identical sequences U3ISU6
ENSAPLP00000010319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]