SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000010331 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000010331
Domain Number 1 Region: 12-116
Classification Level Classification E-value
Superfamily ARID-like 5.23e-34
Family ARID domain 0.00034
Further Details:      
 
Domain Number 2 Region: 523-600
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000000106
Family P4 origin-binding domain-like 0.0091
Further Details:      
 
Domain Number 3 Region: 280-455
Classification Level Classification E-value
Superfamily ARM repeat 0.0000057
Family Clathrin adaptor core protein 0.025
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000010331
Domain Number - Region: 1625-1650
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0724
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000010331   Gene: ENSAPLG00000010567   Transcript: ENSAPLT00000011043
Sequence length 1828
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742451.1:978768:1079009:-1 gene:ENSAPLG00000010567 transcript:ENSAPLT00000011043 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANSTGKNHADQRRKGLAFLDELRQFHHSRGSPFKKIPVVGGKELDLHALYTRVTTLGGF
GKVSEKNQWGEIVEEFNFPRSCSNAAFALKQYYLRYLEKYEKVHHFGEEDDEVQPGNPKP
QLPIGAIPSSYNYQQHSVSDYLRQSYGLSMDFNSPNDYNKLVLSLLSGLPNEVDFAINVC
TLLSNESKHVMQLEKDPKIITLLLANAGVFDDTLGSFSAVFGEEWKEKTDRDFVKFWKDI
VEDIEVRDLISDRSKSQEIPSEDWIWESLFHPPRKLGINDIEGQRVLQIAVILRNLSFEE
GNVKLLAANRTCLRFLLLSAHSHFISLRQLGLDTLGNIAAELLLDPVDFKTTHLMFHTVT
KCLMSRDRFLKMRGMEILANLCKAEDNGVLICEYVDQESYKEIICHLTLPDVLLVISALE
VLYMLTEMGEVACTKISKVEKSIDTLVCLVSMDIQMFGPDALTAVKLIEHQCVNQQGVPD
VRPPVMDHGSSQAHAAGVPASRAAPHVAPPPGIVEIDSEKFACQWLNAHFEVYLDCSVSR
AEMYSEYLSTCSKLARGGILTSTGFYKCLRTVFPNHTVKRVEDPNNNGQAHIHVVGVKRR
AIPLPIQMYYQQQPTSSTPVVRVDSIPDVSSSPSPAVGIPHGPQSVGNHYQRTPINQSST
LTATQMSFPIQGVHTVAQTVSRIPQNPVHAQQQNATMTVIQNKGPIPCEVVKATVIQSSV
PQSGVPVTIAVGGAQASNQNHSSTGPQPSVAVVGSQTLLHHQPVIQQQSPLHAVVPGQIP
SGTPVTVIQQAVPQGHIFGRVQNIPACSSAVSQGQQLITTSSQPGQTSSQPSSTGNQQQD
TVIIAPQQYVTTSASNIVSATTVQNFQVAAGQVVTIAGVQNPPTSRVGFQNIAPKPSQQG
PPNVQQPMQSQQQPQPPPSQQSVVIVSQPAQQGQTYAPAIHQIVLANPASIPAGQTVQLT
GQPSITPSSSPSPGPVTNNQVPTVMSSSCTTSQSQGPPPTVSQMLSVKRQQQQQHSPASS
QQQVQQPIQMQVQSQQANAGVGQPNSGESSLIKQLLLPKRGPSTPGGKLILPAPQIPPPN
NARAPSPQVVYQMANNQAPGYGVQGQSSAQQLLVGQQNVQLVQGAIPPQGAVQTVPISNL
QILPGQLISNSPATIFQGTTGNQVTITVVPNTSFATATVSQGNATQIIAPAGIAVSGTQT
GVGLQVQTLPATQAPSAGQSPCTAAPPFKGDKIICQKEEEAKEATGLHIHERKIEVMENP
SCRRGAANTSNGDAKENEMQVGSLLNGRKYSDSSLPPSNSGKTQNEANQCSQVSNGPSLE
MGENGAPGKQNFEQMDTQEIKSDLKKPLVNGICDFDKGDGSHLSKNIPNHKTSNHVGNGE
ISSVEQQGNLDATQQDTAKGDQGERISNGPVLTLSSSPVVSGTQEAAKLLTQQLSGTNTD
LPNGPLASSLNSDVPQQRPSVVVSPQSTASVIQGHQIIAVPHSGPRVSQSTLSSEVRSTN
GTAECKTVKRPAEDNDRETVPGIPNKVGVRIVTISDPNNAGCSATMVAVPAGADPSTVAK
VAIESAVQQKQQHPTTYIQSMVTQSTPATSIPTVQVQGQQINLQPPSYTAASQHAEQMKK
PGQNFMCLWQSCKKWFQTPSQVFYHAATEHGGKDVYPGQCLWEGCEPFQRQRFSFITHLQ
DKHCSRDALLAGLKQDELGQAGNQKPPNKPPAVGGTPAAPRAQKAIVNHPSAALMALRRG
SRNLVFRDFTDEKEGPITKHIRLTAALILKNIGKYSECGRRLLKRHENHLSVLAISNMEA
SSTLAKCLYELNFTVQSKEHEKDSEMLQ
Download sequence
Identical sequences U3ISV8
ENSAPLP00000010331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]