SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000010334 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000010334
Domain Number 1 Region: 4-170
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.02e-45
Family p120GAP domain-like 0.0000000782
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000010334   Gene: ENSAPLG00000010611   Transcript: ENSAPLT00000011046
Sequence length 177
Comment pep:novel scaffold:BGI_duck_1.0:KB748388.1:400:10673:1 gene:ENSAPLG00000010611 transcript:ENSAPLT00000011046 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YFISCQQKTVEHFWETTNKIQFSSHFSGFVFLRLICPAILNPRMFNIISDSPSPTAARTL
TLVAKSVQNLANLVEFGAKEPYMEGVNPFIKSNKHRMIMFLDELGNVPELPDTTEHSRTD
LSRDLAALHEICVAHSDELRTLSNERGVMQHVLKKLLAITELLQQKQNQYSVSNNIR
Download sequence
Identical sequences U3ISW1
ENSAPLP00000010334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]