SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000010567 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000010567
Domain Number 1 Region: 622-736
Classification Level Classification E-value
Superfamily ARID-like 1.27e-29
Family ARID domain 0.000000432
Further Details:      
 
Domain Number 2 Region: 1711-1845
Classification Level Classification E-value
Superfamily ARM repeat 0.0000089
Family Armadillo repeat 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000010567   Gene: ENSAPLG00000010807   Transcript: ENSAPLT00000011284
Sequence length 1881
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742925.1:97715:133565:-1 gene:ENSAPLG00000010807 transcript:ENSAPLT00000011284 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQMGKMRPQPYGGNNPYTQQQGPQAGPQQGHGYPGQPYGPQTPQRYPMGMQSRTQSTMS
SISYAQQIPPYGQQGPSAYGQQSQTPYYNQQSPHPQQQQPPYSQQPPSQTPHSQPSYQQQ
QQPQSQPPQLQTSQPAYSQQQSQPPHQQSPTPYPQQQSTAQQHQQSQPPYSQQQSQSPYQ
QQQQTQQTASSALSQQSSSYPQSQPQQQQSAYSQQRFPPPQELSQESFGSQASSAPSMAS
SKGQEDMNLNLQSRPSSLPDLSGSIDDLPMGTEGALSPGVSTSGISSSQGEQSNPAQSPF
SPHTSPHLPGIRGPSPSPVGSPASVAQSRSGPLSPAAVPGNQMPPRPPSGQSDSIMHPSM
NQSSIVQDRGYLQRNPQMPQYSSPQPGSALSPRQSSGGQMHAGMGPYQQNSMGSYGPQGG
QYGPQGGYPRQPNYNAMSNANYPSPGMGGSMNPMGAGSQMHGQTGVPPYTGLPPGRMSHA
TMGNRPYGPNMANMPPQVGTGMCPPPGGMNRKAQEAAAAAMHAAANSIQNRPPGYPNMNQ
GGMMGTGPPYGQGINSMAGMINPQGPPYPMGGNMANNSAGMAASPEMMGLADVKLTPATK
MNNKADGTPKAESKSKKSSSSTTTNEKITKLYELGGEPERKIWVDRYLAFTEEKAMGMTN
LPAVGRKPLDLYRLYISVKEIGGLTQVNKNKKWRELATNLNVGTSSSAASSLKKQYIQCL
YAFECKIERGEDPPPDIFAAADSKKSQTKIQPPSPAGSGSMQGPQTPQSTSSSMAEGGDL
KPPTPASTPHSQMPPLPGIRSNSVGLQDAFTDGSDPTFQKRNSMTPNPGYQPSMNTSDMM
GRMSYEPNKDPYSSMRKAPGSDPFMSSGQGPNSGMGDPYNRAAGPGMGNMAMGQRPHYPY
GGPYDRVRTEPGMGPEGNLAAGTPQPNIMPSTPESGMYSPSRYPQQQQQQQRHDSYGNQF
SSQGTSSGSPFPSQQTTMYQQQQQNYKRPMDGSYGPPAKRHEGEMYNVPYSAGQGQTQQQ
LPPAQTQQPSQQQTAQPSPQQDLYNQYGSTYPAADRRSAGGPQNQFPFQFGRDRVSAPPG
SNAQQNMPPQMMGGPIQSAPEGPQQGAMWQGRNEIGYSYPNRQSTGSAPQGPAYHGVTRT
DEILHSEQRVNHEGPWSSHGNRQPPYGPSAPVPPMTRPPQSNYQTPPSMQNHIPQVSSPA
PLPRPLENRTSPSKSPFLHSGMKMQKAGPPVPASHITPAAVQPPMIRRDITFPPGSVEAT
QPVLKQRRRLTAKDIGTPEAWRVMMSLKSGLLAESTWALDTINILLYDDNSIMTFNLSQL
PGLLELLVEYFRRCLIEIFGILKEYEVGDPGQRTLLDPERFCRSSSSSHEEGEEDDEPRS
LNSAFSGKDKVPLESSEEKLVSKFDKLPVKVVQKNDPFVVDYSDKLGRVQEFDSGLLHWR
IGGGDTTEHIQTHFESKMELPLTHKRASCNSVLRKRSAAESNPSTREGETLPSDSSSEKR
ITATMDDMLSARPGSLSGEEEEVKASETAKESSKFPFGISPAQSHRNIKILEDEPHSKDE
TPLCTLLDWQDSLAKRCICVSNIIRSLSFVPGNDFEMSKHPGLLLILGKLILLHHKHPER
KQAPLTYEKEEEQDQGVSCNKVEWWWDCLEMLRENTLVTLANISGQLDLSPYPESICLPI
LDGLLHWAVCPSAEAQDPFPTLGPNAVLSPQRLVLETLSKLSIQDNNVDLILATPPFSRL
EKLYSTMVRFLSDRKNPVCREMAVVLLANLAQGDSLAARAIAVQKGSIGNLLGFLEDSLA
ATQFQQSQAGLMHMQNPPFESTSVDMMRRAARALLALAKVDENHSEFTLYESRLLDISVS
PLMNSLVSQVICDVLFLIGQS
Download sequence
Identical sequences U3ITJ4
ENSAPLP00000010567

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]