SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000010575 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000010575
Domain Number 1 Region: 1-117
Classification Level Classification E-value
Superfamily PH domain-like 6e-42
Family Phosphotyrosine-binding domain (PTB) 0.00017
Further Details:      
 
Domain Number 2 Region: 458-519
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000102
Family SH3-domain 0.00024
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000010575
Domain Number - Region: 655-714
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00126
Family SAM (sterile alpha motif) domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000010575   Gene: ENSAPLG00000010811   Transcript: ENSAPLT00000011292
Sequence length 753
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB745096.1:75046:114860:-1 gene:ENSAPLG00000010811 transcript:ENSAPLT00000011292 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HLATFIMDKSESIVTVDDAIRKLIMLNSKEKIWTQEMLLQVNDKSIRLLDCESQEELEDF
PLPTVQHCQTVLNQMRYASILLLVCQDSEQHKPDIHFFNCDEVENKILSQALSSARSSSL
AGVRQLNASKAKENEQTQPGATIPCVPTFNGAHLQPLIVKKKILSLSLFADYERRGSASQ
DHEESRIILAQKIEKETQILNCALDDIEVFVARLQKAAEAFKQLNQRKKGKKNKKKGPAE
EGVLTLRARPPSEAEFIDCFQKTKLAFNLLAKLRKHIQNPSASELVHFLFGPLELIVNSC
AGPELARSVLSPLLSKDATDFLRGHLTPREISLWDSLGETWTKSRAEWPREANIPTYIPK
FRNGWEPPIEIFRGAPWEIDIGHLQEEVSPMLPTMQLSPLLVALTPRLPFQLSSANGYPY
RNSSLKRGQTGDQTQAVDAFKQNVTQHVNRNFEAQGMALPKRYAKIHYDFTARNANELSV
LRDEVLEVLEENKQWWKLLNRSGQAGYVPYNILDEQAPPEFTKENLTPCFSFLSSRLTRG
QALSLASLPLVAHAVPTWPVPSQSFREIPATRSVNTRPTSLPHLAQAIEDHRIIWVLTST
CYRYQPCKMKLLHHMDEVNDELIRKITNSKIQPPHRNFKVEKPQESFVPLTFESSAEEVK
AWLEAKSFSKGTVEHLGILTGAQLFSLNREELKKVCGDEGNRVYSKITVEKNQLEKNRGE
TELQEIMKRRQERIDSANSAEKGNKSNDPQSRQ
Download sequence
Identical sequences U3ITK2
ENSAPLP00000010575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]