SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000010610 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000010610
Domain Number 1 Region: 1075-1395
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.67e-94
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.000000382
Further Details:      
 
Domain Number 2 Region: 869-1043
Classification Level Classification E-value
Superfamily ARM repeat 7.04e-59
Family Phoshoinositide 3-kinase (PI3K) helical domain 0.0000814
Further Details:      
 
Domain Number 3 Region: 359-528
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.91e-39
Family Ras-binding domain, RBD 0.015
Further Details:      
 
Domain Number 4 Region: 683-847
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 7.59e-36
Family PLC-like (P variant) 0.024
Further Details:      
 
Domain Number 5 Region: 1425-1544
Classification Level Classification E-value
Superfamily PX domain 1.1e-29
Family PX domain 0.00093
Further Details:      
 
Domain Number 6 Region: 1562-1689
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 7.14e-25
Family Synaptotagmin-like (S variant) 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000010610   Gene: ENSAPLG00000010801   Transcript: ENSAPLT00000011327
Sequence length 1693
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742766.1:324619:358388:1 gene:ENSAPLG00000010801 transcript:ENSAPLT00000011327 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQISSSNGFKQRSSPSLATARSKDVDKEEALQMEAEALAKMQKERGIAGNKQAFHSVSS
TRQTAQTHSKQDHDLMVFPESDAKRMEDKLSTIDIEKLTHAELEKLLLDDSFEASKAPTL
PVTPILSPSLSSQFYLGPAGQRGQWTPGIPAPVTCTLPPIYPSASYTKQTGVFQNGFHPS
MSSYHSREPLYLGLPRQSQYISYPLAATTPFHPQGSLPIYPPVLTPEMAKVFDKIASTSE
FLKNGKSSTDLEMTAIKSAVSDLPASESCRDISKFDWLDLDPLSKPKVDSVETLYKAEDD
GETASSLTAEDPWDAVLLEEKLLVTCHLERKINGKSAGATVTRSQSLNMRTTQLAKLQGQ
TSQKDNGTTGLLTENALLQEIEGQNEELSAFSQTVTKLRTKFPYADQQTNPGFVLSPIML
QRNISGESASIKVSIEIQGFQQPVTFTCDVSSPVELIIMQALCWVHDDLSEVDIGSYILK
VCGQEEVLQNKHCVGSHEYIQNCRKWDTEIKLQLVTHSVMCRGLARTEEDDRTPIHLTKH
LYKVEKPFREPIIRCSLEELLEVYHKQTEIALKNENQHKAVDQLIKTVRKICSTLDGVET
PAITESVKKLRRAVNLPRTKNTEVSLKCGDDPSKSSSGSLQPESPLKVSIDQLTRAVEAL
LQLHMNSCSSSSAAISPEDKSTKEAWTATEHLQFTVFAAHGIFPGWVANYEKYYLICSLT
HNGKDLFKPVQSKKVGTYKNFFYLIKWDELIIFPIQISQLPLESVLCLTLFGILNQSSGS
SPDSNKQRKGPEMLGQVSLPLFDFRRLLTCGTKLLQLWTSSHPNHASGTASKKGNMERIV
LQVDFPSHAFDIEYKIPQAAKTTVQHSIETLEKPMRERLLAILAKDNTIGLSKEDKEFLW
EKRHYCHTHTNSLPKILASAPHWDWASLPEIYSLLQQWPPLSPLAALELLDSKFADQEVR
NTAMNWIETLSDDELTDFLPQFVQALKYETYLDSALVQFLLARALGSIRIAHYLYWLLKD
TLYDSKFGVRYEQILGAFFSVCGKGLREELEKQTRLVQLFGMVAEKVKQTSVSGRQAALQ
SGMERVQSFFLKNKCRLPLNPSLVAKELNIKACSFFSSNAVPLKVALINADPLGEEINVM
FKVGEDLRQDMLALQMIKIMDKIWLQEGLDLRMVIFKCLSTGKDRGMVELVPASETLRKI
QVEYGVTGSFKDKPLAEWLRKYNPTEEEYEKASENFIYSCAGCCVATYVLGICDRHNDNI
MLRNTGHMFHIDFGKFLGHAQMFGSFKRDRAPFVLTSDMAYVINGGEKPTIRFQLFVDLC
CQAYNSIRKHANLFLNLLSLMLSSGLPELSSIQDLKYVQDALQPQTTDAEATIFFTRLIE
SSLGSVATKFNFFIHNLAQLRFSGLPSNDEPILSFSAKTYSLKQDGRIKHVSVFTYQKRY
NPDKHYIYVVRVLREGQAEPTFVFRTFDEFQELHNKLGILFPLWKLPGFPNKMVLGRTHI
KDVAAKRKVELNSYIQSLMNSSSEVSECDLVYTFFHPLLRDDKVEGIDGIARSTDASPSS
PTSGKVGGEVKLSISYRNSTLFIMVMHIKDLVTEDGADPNPYVKTYLLPDTHKTSKRKTK
ISRKTRNPTFNEMLVYSGYSMETLKQRELQLSVLSAESLRENFFLGGITLSLKDFNLSKE
TVNWYRLTAVPYL
Download sequence
Identical sequences U3ITN7
ENSAPLP00000010610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]