SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000010652 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000010652
Domain Number 1 Region: 1-74,340-458
Classification Level Classification E-value
Superfamily GroEL equatorial domain-like 2.88e-58
Family Group II chaperonin (CCT, TRIC), ATPase domain 0.0017
Further Details:      
 
Domain Number 2 Region: 138-313
Classification Level Classification E-value
Superfamily GroEL apical domain-like 2.62e-51
Family Group II chaperonin (CCT, TRIC), apical domain 0.00011
Further Details:      
 
Domain Number 3 Region: 75-142,303-340
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 9.46e-24
Family Group II chaperonin (CCT, TRIC), intermediate domain 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000010652   Gene: ENSAPLG00000010870   Transcript: ENSAPLT00000011369
Sequence length 466
Comment pep:novel scaffold:BGI_duck_1.0:KB742489.1:1662670:1668101:1 gene:ENSAPLG00000010870 transcript:ENSAPLT00000011369 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QIQHPTASLIAKVATAQDDITGDGTTSNVLIIGELLKQADLYISEGLHPRIVAEGFEIAK
EKALEVLEQVKVTKEMDRETLIDVARTSLRTKVHTELADILTEVSAVVDSVLAVRKQDEP
IDLHMVEIMEMKHKSETDTALIRGLVLDHGARHPDMKKRVEDAYILTCNVSLEYEKTEVS
SGFFYKSAEEREKLVKAERKFIEDRVNKIIDLKRRVCGDSDKGFVVINQKGIDPFSLDAL
AKEGIVALRRAKRRNMERLTLACGGTAMNSVEDLTPDCLGHAGLVYEYTLGEEKYTFIEK
CDNPRSVTLLIRGPNKHTLTQIKDAVRDGLRAVKNAIEDGCVVPGAGALEVAVANALVKH
KPNVKGRAQLGVQAFADALLIIPKVLAQNSGYDPQETLVKVQTEHAESGQLTGVDLNTGE
PMVAAAAGIWDNYNVKKQLLHSCTVIASNILLVDEIMRAGMSSLKG
Download sequence
Identical sequences U3ITS9
ENSAPLP00000010652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]