SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000010654 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000010654
Domain Number 1 Region: 2-56
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000000000000175
Family Tudor domain 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000010654   Gene: ENSAPLG00000010912   Transcript: ENSAPLT00000011371
Sequence length 199
Comment pep:novel scaffold:BGI_duck_1.0:KB743474.1:79683:82596:-1 gene:ENSAPLG00000010912 transcript:ENSAPLT00000011371 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLQWKVGDSCNAVWSEDGNVYLATIVSINQKRGTCVVTYDGYGNKEEQNLSDLLLPANDE
TKNVLVFQNENETPYSTDESEKSFQSPQNKNNCTKARFSPQNFRFPIPPAAPSLGRVSLV
LSASGSKLRTPPPFLSCWPPPFPAGPPLIPPPPPMGPDSPEDDEALGSMLIAWYMSGYHT
GYYLGLKQSRMEAALERES
Download sequence
Identical sequences U3ITT1
ENSAPLP00000010654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]