SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000010677 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000010677
Domain Number 1 Region: 221-332
Classification Level Classification E-value
Superfamily ARID-like 7.06e-34
Family ARID domain 0.000000722
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000010677   Gene: ENSAPLG00000010915   Transcript: ENSAPLT00000011394
Sequence length 368
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742802.1:886905:988168:1 gene:ENSAPLG00000010915 transcript:ENSAPLT00000011394 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QDEVIAVSEKVTVKLEDLAKWAQSDFSKWKCGFRAEPVKPMDVGKNGQKEALMRYRQSTL
NSGLNFKDILKEKADLGEDDEDSNLLILSYPQYCRYRSMLKRIQDKPSSILTDEFVLALG
GIAVTSKNPQIFYCRDTFDHPTLIENESICDEFAPNLKGRPRKKKPCPQRRDSLNGIKDS
NNNSESKAVAKVKCEAKSALPKPKSNNSNCKKGSSEDKSKIAVGEECRADEQAFLVALYK
YMKERKTPIERIPYLGFKQINLWTMFQAAQKLGGYETITARRQWKHIYDELGGNPGSTSA
ATCTRRHYERLILPYERFIKGEEDKPLPPVKPRKQDNSSQEGEVKTKVSGTKRIKNENQK
SKKEKDNA
Download sequence
Identical sequences U3ITV4
ENSAPLP00000010677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]