SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000010721 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000010721
Domain Number 1 Region: 719-988
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 3.48e-107
Family N-acetyl transferase, NAT 0.000000000998
Further Details:      
 
Domain Number 2 Region: 256-327
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.59e-17
Family PHD domain 0.005
Further Details:      
 
Domain Number 3 Region: 102-180
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000544
Family Linker histone H1/H5 0.022
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000010721
Domain Number - Region: 202-270
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00128
Family PHD domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000010721   Gene: ENSAPLG00000010936   Transcript: ENSAPLT00000011438
Sequence length 2026
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742808.1:1520741:1622847:1 gene:ENSAPLG00000010936 transcript:ENSAPLT00000011438 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVKLANPLYTEWILEAIQKVKKQKQRPSEERICHAVCASHGLDKKTVSEQLELSVQDGSI
LKVTNKGLASYKDPDNPGRFSAVKPGTIPKSVKGSRGACNELRNVDWNKLLRRAIEGLQE
PNGSSLKNIEKYLRSQNDLANIFNNPAFQQRLRLGAKRAVNNGRLLKDGPQYRVNYGGLE
SKGPPKYPSAFPASLPPVSLLPHEKDQPRADPIPICSFCLGTKESNREKKPEELLSCADC
GSSGHPSCLKFCPELTTNVKALRWQCIECKTCSACRIQGKNADNMLFCDSCDRGFHMECC
DPPLSRMPKGMWICQVCRPKKKGRKLLHEKAAQIRRRYAKPIGRPKNKLKQRMLSVTSDE
GSVNAFTGRGSPGRGQKTKVCTTPSSGHAASVKDSSSRLPVTDPTRPGATTKITTTSTYI
SASTLKVNKKTKGLIDGLTKFFTPSPDGRRSRGEIIDFSKHYRPRKKVSQKQSCTSLVLA
TGTTQKLKPPPSSLLPPTPISGQSPSSQKSSTSTSSNSPQSSSSQSSAPSFSSLPSNSQL
KGLFDGLSHIYTAQGQSRKKGHPSYAPPKRMRRKPELSSTSKSNSHFYGKKEVRSRFISR
ACTSGWGVSRGHAFKAIAHLKRTTFLKKHRILGRLKYKVTPQMGTPSPGKGSLADGRIKP
DQDDDTEIKLSIKQENTDVFLVGSKDTVTQEDLEVFKQARELSLEKIGCKNTGETSGRYP
SVIEFGKYEIQTWYSSPYPQEYASRLPKLYLCEFCLKYMKSKNILLRHSKKCGWFHPPAN
EIYRRNDLSVFEVDGNVSKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTKNDEKGCHL
VGYFSKEKLCQQKYNVSCIMIMPQYQRQGFGRFLIDFSYLLSRREGQAGSPEKPLSDLGR
LSYLAYWKSVILEYLNCHHEKQISIKGMSRATGMCPHDIATTLQQHSMIDKREDRFVIIR
REKLISSHMEKLKANPRINEVDPESLRWTPLLVSNAAVSEEEREAEKEAERLMEQASCWE
KEEQEIFSTRTNSRQSPAKVQSKNKYLRSPESVAVVGERGQSTEQSKESSEEDGGDENQQ
SSPPRLTKPQSLTMKRKRPFLLKKKRGRKRRRINSSVTTETISETTEVLNEPFDNSDEER
PMPQLEPTCEMDGEDDDLKPVIRKTFEYQPGQQKQEEEEEQNKEEKDIRCYRSDDNCTNN
TDDVAVLEESTKDNLEPLKSKQGWPKGVKRGPSKWRQNKERKPGFKLNLYTPPETPMEPD
YQVLVEEQKEVAEDKPCPVPAVTEEEIKEPAEGLPPPDDKVKEVEPEPLHPSSEPFEKQE
NDTVKAGEEERNVEESGIDSKDEEKDKPDEAFLQKEESVHLDDHEEEEEDDEEPSHNEDH
DADDEDDSHMGSAEVEKEDLPGEAFKEMLETQQSFLDVNVQTGNSNQEDLMNCSVDLAAD
ECESDQKEVTTDSDPVPESDDDHADNNQDQKADEELHSDFKGESSETMEIDSETVQAVQS
LTQEASEHEDTFQDCAETQEACRSLQNYAHTDQSPQMTTLDDCQQSDHSSPVSSVHSHPS
QSVRSVNSPNVAPLENNYAQISPDQSAISVPSLQNMETSPMMDVPSVSDHSQQVVDSGFS
DLGSIESTTENYENPSSYDSTMGSSICGNNSSQNSCSYSSLTSSNLTQSSCAVTQQMSNI
NGSCSMMQQTNISSPPTCNVKSPQGCVVERPPSSNQQLSQCSMAANFTPPMQLTEIPETG
NANIGLYERMGQSEFGPGHYSQPSATFSLAKLQQLTNTLMDHSLPYSHSAAVTSYANSAS
LSTPLSNTGLVQLSQSPHAVPGGPQAQATMTPPPNLTPPPMNLPPPLLQRNMTSSNIGIS
HTQRLQTQMASKGHVSVRTKSTPLPPAAAAHQPQIYGRASQTVAMQGPARTLTMQRGMNM
SVNLMPAPAYNVNSVNMNMNTLNAMNGYSMSQPMMNSGYHSNHGYMNQTPQYPMQMQMGM
MGTQPYAQQPMQTAPHSNMMYTPPGHHGYMNTGMSKQSLNGSYMRR
Download sequence
Identical sequences U3ITZ8
ENSAPLP00000010721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]