SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000010764 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000010764
Domain Number 1 Region: 222-365
Classification Level Classification E-value
Superfamily PH domain-like 4.92e-41
Family Third domain of FERM 0.00000942
Further Details:      
 
Domain Number 2 Region: 118-223
Classification Level Classification E-value
Superfamily Second domain of FERM 9.68e-37
Family Second domain of FERM 0.00000428
Further Details:      
 
Domain Number 3 Region: 40-117
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.58e-26
Family First domain of FERM 0.0000766
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000010764   Gene: ENSAPLG00000011001   Transcript: ENSAPLT00000011481
Sequence length 685
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742432.1:940487:997461:1 gene:ENSAPLG00000011001 transcript:ENSAPLT00000011481 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KVAEEKEEKQEKEKRETKEVQTAEVISQKSPKKIKTVQSKVVLLDGTEYTCDLEKRAKGQ
ILFDKVCEHLNLLEKDYFGLLFYENSDQKNWLDPSKEIKRQIRSLPWLFTFNVKFYPPDP
SQLTEDITRYFLCLQLRQDIASGRLPCSFVTHALLGSYILQAEMGDHDPEEHHGDYISEF
QFAPNQTQEMEEKVAELHKTHRGLTPAQADSQFLENAKRLSMYGVDLHHAKDSEGVDIML
GVCANGLLIYKDRLRINRFAWPKILKISYKRSNFYIKIRPAELEQFESTIGFKLPNHRAA
KRLWKVCVEHHTFFRLLSPEQPPKAKFLTLGSKFRYSGRTQAQTRQASNLIDRPAPYFER
TSSKRVSRSLDGDFPTTGRPSAGDKIIDLEAPGQGKLKEGGREDDVSPLKTPQLELTQDG
KDNDLNDKAEEEEVCNSVAMLTLCIASMLALQEASSVLCADRDIYLISQSNSLRVDGENI
YVRHSNLMLEDLDKTQDDLLKHQASISELKRNFMESTPEPRPNEWEKRRITPLSLQTQGV
CHYCLFLAPPPVVKTEMVTISDATQRTEISTKEVPIVQTETKTITYESPQFDGSADGSAG
VLLSAQTITSESISTTTTTHITKMVKGGVSETRIEKRIVITGDGDIDHDEALAQAIKEAK
EQHPDMSVTRVVVHKETELAEEDED
Download sequence
Identical sequences U3IU41
ENSAPLP00000010764

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]