SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000010818 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000010818
Domain Number 1 Region: 170-263
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.48e-33
Family ets domain 0.00000639
Further Details:      
 
Domain Number 2 Region: 24-129
Classification Level Classification E-value
Superfamily SAM/Pointed domain 9.06e-29
Family Pointed domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000010818   Gene: ENSAPLG00000011073   Transcript: ENSAPLT00000011536
Sequence length 268
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742537.1:58200:69526:-1 gene:ENSAPLG00000011073 transcript:ENSAPLT00000011536 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YPSLPRFQEVMLDSVTHSTFLSNAMVCDPLMSWTELFGTTEDGYPTCDHQTDSDSFWTSI
HPEYWSKHNVCEWLQFCCDQYKLDANCISFSHFNINGLQLCNMTQEEFLDAAGICGEYLY
FILQNIRMHGISFFTDVEETKPTNKDFPARDKACVRAGGINGQECHSHGRTNLQSSHLWE
FVRDLLLSPEENGGILEWEDRGQGIFRVVKSEALAKMWGQRKKNDRMTYEKLSRALRYYY
KTGILERVDRRLVYKFGKNAHGWQENKI
Download sequence
Identical sequences U3IU95
ENSAPLP00000010818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]