SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000010845 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000010845
Domain Number 1 Region: 2-71
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000000269
Family SAM (sterile alpha motif) domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000010845   Gene: ENSAPLG00000011115   Transcript: ENSAPLT00000011563
Sequence length 515
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742432.1:1257623:1293438:1 gene:ENSAPLG00000011115 transcript:ENSAPLT00000011563 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESWSVDQVCNWLRQRNLEELVPKFREEEVSGAALLALNDRMVQQLVKKIGHQAVLMDLI
NKYQQQNSNLKSPENSNSISFVSVAEAGTVYRASLKFRASEEIRVFLSASENEEGLIDQR
VLKQKRNLRSCSAVCKMLHWKNSYTLPAFPYDVKILLAEKKCPDHSMRIRIIECLQADMT
KYLAGSLYPNSQQYNFVVSALLQAYPFLDDDGNGFSVWKRALKDRFKYVRRTIEDDEQVL
RNKCKFGHRRGQRRKSSSGSVISQTIELAVCKSESSCGDAMYENINWLKQEYMKTQRNWN
EVNNRMNATIQIRRKMISDKAPLQDILRVFPFLRCPYQLFREFQILTHMNIYQKTVEILE
IYSENILSLYLVKNNPITIMLQENLKQHTEEDILKYMKMTAACLLLPDVFGDDSSLFAAV
NEEVKVVTPVLEVKNPFNVNSCEFALYVEKQEVAQLEDCTTALAALVAAFYVFDIPCPNR
IYRTLNFLESLVFEMRCPAFLPAQDDEFSFFYPCM
Download sequence
Identical sequences U3IUC2
ENSAPLP00000010845

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]