SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000010850 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000010850
Domain Number 1 Region: 188-258
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.26e-23
Family P4 origin-binding domain-like 0.0000286
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000010850   Gene: ENSAPLG00000011096   Transcript: ENSAPLT00000011568
Sequence length 661
Comment pep:novel scaffold:BGI_duck_1.0:KB742461.1:1007:55936:-1 gene:ENSAPLG00000011096 transcript:ENSAPLT00000011568 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQTSETGSDTGSTVTLQTSVASQAAVPTQVVQQVPVQQQVQQVQTVQQVQHVYPAQVQYV
EGSDTVYTNGAIRSTTYPYTETQMYSQNTGGNYFDTQGSSAQVTTVVSSHSMVGTGGIQM
GVTGGQLISSSGGTYLIGNSMENSGHSVTHTTRTSPATIEMAIETLQKSDGLSTHRSSLL
NSHMRFIXLDNYETAEGVSLPRSTLYNHYLRHCQEHKLDPVNAASFGKLIRSIFMGLRTR
RLGTRGNSKYHYYGIRVKPDSPLNRLQEDMQYMAMRQQPMQQKQRYKPMQKVDGVADGFT
GSGQQTGTSAEQTIIAQSQHHQQFLETDASRVLPEFGEVEISSLPDGTTFEDIKSLQSLY
REHCEAILDVVVNLQFSLIEKLWQTFWRYSPSTPPDGTTINEPRLANYSKVSCDTRSKVL
FTVVEPSLLFFIFCKCIFIYSFAAFVHSSNLSLRPIPSALTQAIRNFAKSLEGWLSNAMN
NIPQRMIQTKVAAVSAFAQTLRRYTSLNHLAQAARAVLQNTSQINQMLNDLNRVDFANVQ
EQASWVCQCDDNMVQRLETDFKMTLQQQSTLEQWAAWLDNVMMQALKPYEGRPSFPKAAR
QFLLKWSFYSSMVIRDLTLRSAASFGSFHLIRLLYDEYMFYLVEHRVAQATGETPIAVMG
E
Download sequence
Identical sequences U3IUC7
ENSAPLP00000010850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]