SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000010896 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000010896
Domain Number 1 Region: 268-402,429-566
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.13e-67
Family Ankyrin repeat 0.00011
Further Details:      
 
Domain Number 2 Region: 2-250
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.12e-57
Family Ankyrin repeat 0.0000561
Further Details:      
 
Domain Number 3 Region: 577-722
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.85e-40
Family Ankyrin repeat 0.0001
Further Details:      
 
Domain Number 4 Region: 882-1007
Classification Level Classification E-value
Superfamily ADP-ribosylation 7.19e-23
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.0047
Further Details:      
 
Domain Number 5 Region: 803-864
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000000181
Family SAM (sterile alpha motif) domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000010896   Gene: ENSAPLG00000011056   Transcript: ENSAPLT00000011614
Sequence length 1022
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742671.1:418367:439666:1 gene:ENSAPLG00000011056 transcript:ENSAPLT00000011614 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FGRKDVVEYLLQSGANVHARDDGGLIPLHNACSFGHAEVVNLLLRHGADPNARDNWNYTP
LHEAAIKGKTDVCIVLLQHGAEPTIRNTDGRTALDLADPSAKAVLTGEYKKDELLESARS
GNEEKMMSLLTPLNVNCHASDGRKSTPLHLAAGYNRVKIVQLLLQHGADVHAKDKGDLVP
LHNACSYGHYEVTELLVKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSYGADPTLLN
CHNKSTIDLAPTPQLKERLAYEFKGHSLLQAARESDVARIKKHLSLETVNFKHPQTHETA
LHCAAASPYPKRKQVCELLLRKGANINEKTKDFLTPLHVASEKAHNDVVEVVVKHEAKVN
ALDNLGQTSLHRAAHCGHLQTCRLLLSSGCDPSIVSLQGFTALQMGTESVQQLLQEGIPL
GNSDADRQLLEAAKAGDVDTVKKLCTVQSVNCRDIEGRQSTPLHFAAGYNRVSVVEYLLQ
HGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAAAKGKYEI
CKLLLQHGADPTKKNRDGNTPLDLVKDGDTDIQDLLRGDAALLDAAKKGCLARVKKLCSP
DNVNCRDTQGRHSTPLHLAAGYNNLEVAEYLLQHGADVNAQDKGGLIPLHNAASYGHVDV
AALLIKYNACVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPTLKNQEGQTPLDLVTA
DDVSALLTAAMPPSALPSCYKPQTTGSTADSLSSVPSSPSSLSAASSLDNLSGSFSELPS
VVGTNSSEGATVLEKKEDPVSGVDFSINQFVRNLGLEHLIDIFEREQITLDVLVEMGHKE
LKEIGINAYGHRHKIIKGVERLISGQQGLNPYLTLNTSSSGTILIDLSSEDKEFQSVEEE
MQSTVREHRDGGHAGGVFNRYNILKIQKVCNKKLWERYTHRRKEVSEENHNHANERMLFH
GSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPIHKDRSCYV
CH
Download sequence
Identical sequences U3IUH3
ENSAPLP00000010896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]