SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000010897 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000010897
Domain Number 1 Region: 254-363
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 3.5e-46
Family MBT repeat 0.000000981
Further Details:      
 
Domain Number 2 Region: 362-479
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.24e-42
Family MBT repeat 0.0000421
Further Details:      
 
Domain Number 3 Region: 448-545
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 7.15e-39
Family MBT repeat 0.0000127
Further Details:      
 
Domain Number 4 Region: 705-772
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000000114
Family SAM (sterile alpha motif) domain 0.0017
Further Details:      
 
Domain Number 5 Region: 557-598
Classification Level Classification E-value
Superfamily CCHHC domain 0.00000000942
Family CCHHC domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000010897   Gene: ENSAPLG00000011121   Transcript: ENSAPLT00000011615
Sequence length 782
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742432.1:1296610:1372909:-1 gene:ENSAPLG00000011121 transcript:ENSAPLT00000011615 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNESAASGNGQEFDVFSAMDWKDGIGTLPGSDLKFRVNEFGALEVITDETEMENVKKATA
TTTWMVPTAQEGQAGFPACPQILLTSYKDNSSGDPSAFSEKTGIPTKLKETAKMDGLVFC
ENCYRYGTIEEFVPEGKFCSQKCAQQVKNKEPKEEKPNVECNGEDDSKGIRKRKAKLPLK
EESRDNGEKSESEKEDKPEGRILRVSQRARRKRKGEITVLKQTVHSKGKQAWCWASYLEE
EKAVAVPTKLFKEYQSFPYNKNGFKVGMKLEGVDPEHQSIYCVLTVAEVCGYRIRLHFDG
YPDCYDFWVNADSSDIHPVGWCEKTGHKLHPPKGYKEEEFSWPSYLKACKAQAAPKSLFE
NQNTTVIPSGFRVGMKLEAVDKKNPTFICVATVTDMVDNRFLVHFDNWDESYDYWCEAAS
PHIHPVGWCKEHKRTLITPPDYPHAKHFSWEKYLEETSSLPAPARAFKVKPSHGFQKNMK
LEVVDKRNPVFIRVATIVDTDDYRIKVHFDGWDSIYDYWTDVDSPDIHPAGWCTKTGHPL
QPPLSPLELVEALEHGGCPTAGCKGVGHIKRARHIGHHSAVSCPYSEMNLNKESLLPDRL
SGEMPATNPVPRNRRVEARERSPSPVINGVLQTKDSIKNKECEEEEIENKLLISNEIKED
TEEPNTQRLLSQPVVVSSKLQIPGLPLRWEQHSKLLPSVAGIPASKVSKWSTDEVSEFIR
SLPGCEEHGKVFKDEQIDGEAFLLMTQSDIVKIMSIKLGPALKIFNSILMFKAAEKNSHN
EL
Download sequence
Identical sequences U3IUH4
ENSAPLP00000010897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]