SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000010902 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000010902
Domain Number 1 Region: 270-397,719-894
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 6.1e-52
Family Diacylglycerol kinase-like 0.013
Further Details:      
 
Domain Number 2 Region: 3-124
Classification Level Classification E-value
Superfamily PH domain-like 9.97e-30
Family Pleckstrin-homology domain (PH domain) 0.0035
Further Details:      
 
Domain Number 3 Region: 1098-1164
Classification Level Classification E-value
Superfamily SAM/Pointed domain 9.14e-20
Family SAM (sterile alpha motif) domain 0.004
Further Details:      
 
Domain Number 4 Region: 170-239
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000366
Further Details:      
 
Domain Number 5 Region: 110-166
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000374
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000010902   Gene: ENSAPLG00000011129   Transcript: ENSAPLT00000011621
Sequence length 1172
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743032.1:484985:560220:1 gene:ENSAPLG00000011129 transcript:ENSAPLT00000011621 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QTSIKEGLLLKQTSSFQRWKKRYFKLRGRTLYYAKDSKSLIFDEVDLSDASVAESSTKNV
NNSFTIITPFRRLILCAENRKEMEDWISSLKSVQSREHYETAQFNVEHFSGMHNWYACSH
ARPTFCNVCRESLSGVTSHGLSCEVCKFKAHKRCAVRATNNCKWTTLASIGKDIIEDEDG
IAMPHQWLEGNLPVSAKCAVCDKTCGSVLRLQDWKCLWCKAMVHTACKDLYPRKCPLGQC
KVSIIPPTALNSIDSDGFWKATCPPSCASPLLVFVNSKSGDNQGVKFLRRFKQSLNPAQV
FDLMNGGPHLGLRLFQKFDNFRILVCGGDGSVGWVLSEIDKLSLHKQCQLGVLPLGTGND
LARVLGWGGSCDDDTQLPQILEKLERASTKMLDRWSKFILMDRNAVLIGSEVITFDSLLD
IEMQKISAYEDSVAAHLAKILNSDQHSVVISSAKILCETVKDFVAKIGKTYEKPMENADE
ADAMAIKCSELNEKLDLLLQALHTEAQAAPILPGITPHIVEEEGEEFSSEESLSESKEQL
AECVPKSSTQKLFKPREQLMLRANSLKKAVRQIIEQAEKAVVDEQNAHSEEQETHLLLGM
ENSVCHITKLTCPPLCHKEKVFFPVFRGKIKTAPRSPDRRTSRGIHSQTGSFSAPALAAS
KENLPVLNTRIICPGLRAGLAASIAGSSIISKMLLANIDPFGATPFIDPDPDSLEGYSEK
CVMNNYFGIGLDAKISLEFNNKREEHPEKCRSRTKNMMWYGVLGTKELLQRTYKNLEQKV
QLECDGQYIPLPSLQGIAVLNIPSYAGGTNFWGGTKEDDIFGAPSFDDKILEVVAVFGSM
QMAVSRVIKLQHHRIAQCRSVKITILGDEGVPVQVDGEAWIQPPGVIKIVHKNRAQMLTR
DRAFENTLKSWEDKQKYDSCKPVIRSPLYPQQAELATEEEVTQIQLCSQAAEELITRICE
AAKIHGLLEQELAHAVNACSHALNKANPRFPESLTRNTAMEIAVNVKALHNETESLLVGR
VPLQLEAPHEELLSDALHSVETELRKLAEIPWLYYVFQPNDDEDPPLDYAKRNNRSTVFR
IVPKFKKEKIQKHKTSPQPVQKWGTDEVAAWLDLLSLGEYKEIFISHDIRGSELLHLERR
DLKDLGITKVGHMKRILQGIKELSKNTPLSDV
Download sequence
Identical sequences U3IUH9
ENSAPLP00000010902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]