SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000010942 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000010942
Domain Number 1 Region: 169-268
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.55e-32
Family Ras-binding domain, RBD 0.0024
Further Details:      
 
Domain Number 2 Region: 307-421
Classification Level Classification E-value
Superfamily PH domain-like 4.66e-17
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000010942
Domain Number - Region: 127-199
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00149
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000010942   Gene: ENSAPLG00000011179   Transcript: ENSAPLT00000011661
Sequence length 662
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743574.1:46245:93548:1 gene:ENSAPLG00000011179 transcript:ENSAPLT00000011661 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQTCDDIDEMFSNLLGEMDMLTQSLGVETIQPPSPNMSNKECSFTVGFKDLNESLSALE
DKDLDALMADLVADINEVEQRTLQAQKTSSGNQQSVVTQPSTGLDSDIYSKSSPYVTITG
RFGDDLPPPPPVPDLDLPPPPPPPPSEPLSQEEREAQAKADKIKLALEKLKEAKVKKLVV
KVHMYDNSTKSIMVDERQVTRDVLDNLFEKTHCDCNVDWCLYEMYPELQIERFFEDHENV
VEVLSDWTRDTENKILFLEKREKYALFKNPQNFYLANKGKNESKEMNDKNKEALLEESFC
GASVIVPELEGALYLKEDGKKSWKRRYFLLRASGIYYVPKGKTKTSRDLACFIQFENMNV
YYGSQHKVKYKAPTDHCFVLKHPQIQKESQYIKYLCCDDQATLHQWVTGIRIAKYGKTLY
DNYKCAVKKAGLSSRWTNQGTVEPAAPTGSLSTGTKAANGQIPQIVPPSRAEVAETQKQV
DTSEAQVKPNDLSAPGLAQPVLRPQKYVNKRNSLQPPPPPERRSSAISASPILPSKVKRD
SGIFLADPETFPAPPPSLMVGLPPPPPSDVCEPPPDFVPPPPPSSSSGDEDLPLPPPPPP
VSSKPPPLMKKPVPVPSKRHENAVQDGEPRSAGPPPIGGGGRQADFMSDLMKALEKKRGS
SS
Download sequence
Identical sequences U3IUL9
ENSAPLP00000010942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]