SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000011045 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000011045
Domain Number 1 Region: 953-1080,1112-1319
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.06e-76
Family p120GAP domain-like 0.00021
Further Details:      
 
Domain Number 2 Region: 17-181
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.9e-39
Family Calponin-homology domain, CH-domain 0.0000189
Further Details:      
 
Domain Number 3 Region: 1544-1641
Classification Level Classification E-value
Superfamily RGC domain-like 7.45e-33
Family RGC domain 0.00000176
Further Details:      
 
Domain Number 4 Region: 615-818
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000000319
Family Nucleotide and nucleoside kinases 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000011045   Gene: ENSAPLG00000011175   Transcript: ENSAPLT00000011766
Sequence length 1641
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB745374.1:43558:98978:1 gene:ENSAPLG00000011175 transcript:ENSAPLT00000011766 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLDNERLTAEEMDERRRQNVAYEYLCHLEEAKRWMEACLNEELPPTTELEEGLRNGVYLA
KLGNFFSPKVVSVKKIYDREQTRYKATGLHFRHTDNVIQWLNAMAEIGLPKIFYPETTDI
YDRKNMPRCIYCIHALSLYLFKLGLAPQIQDLYGKVDFTEEEISNMRLELEKYGIQMPAF
SKIGGILANELSVDEAALHAAVIAINEAIDHQVPADTLMAMKNPNAMLINLDDQLESTYQ
DTLYRAKQDKMENAKNRIASENSERERDVYEELLTQAEIQGNINKVNTHAAISKIGLALE
QGDALALYEALATPALGLRGLLRENCDWYFKQFLSDRQQKKEAGLTGLLQKEELQLGVDA
ANRAAQQYQQRLAAVAKINSAIRMGDAEKTVAEMMNPEAQLPEVYAFAAALYQRELSTLQ
QQSHEGNLTHPELSVAVEMLSSVALINRALDSGDVNTVWKQLSSPVTGLTNIEDENSQRY
IDDLIKLKSQTRAEGNEFITWNDIQSCVDRVNLAVHEEHERILAIGLINEALDEGDTKKT
LQALQIPAAKLEGVAPKVAQHYQDTLLRAKREKAQDTQDETAVLWLDEIQDGIHRANKDT
EESQRFSLGILAINEAVDHGDVGHTLSALRSPDVGLYGVTPECAETYQRELAEVKSGKMA
TGGNGSEWVKLWVRGGYNYYHNLRTKEGGWDEPDGFVQNDTQLSREEIQSTISGVTAAYN
REQLWLANENLITKLQACCRGYLVRQEFNSRMNFLKKQVPAITCIQSQWRGYKQRKAYQI
RLDYLRAHKDQVVKIQSMTRMYQARRRYRDRLQYFRDHINDVIKIQAFIRANKAREDYKT
LINAENPPMAVVRKFVHLLDQSDQDFQEELELMKLREEVVTLIRSNQQLENDLNLMDIKI
GLLVKNKITLQDVVSHSKKLTKKNKEQLSDMMMLNKQRGGLKALSKEKREKLEAYQHLFY
LLQTNPTYLAKLIFQMPQNKSTKFMDSVIFTLYNYASNQREEYLLLRLFQTALQEEIKSK
VDQIHEIVTGNPTVIKMVVSFNRGARGQNALRQILAPVVKEIIDDKSLNIKTDPVDIYKS
WVNQMESQTGEASKLPYDVTPEQALNHEEVRTRLDASIRNMRTVTDKFLSAIVSSVDKIP
YGMRFIAKVLKDSLYEKFPDAGEDELLKIVGNLLYYRYMNPAIVAPDAFDIIDLSAGGQL
TTDQRRNLGSIAKMLQHAASNKMFMGDNAHLSIINEYLSQSYQKFRRRFFQAACEVPELQ
DKFNIDEYSDLVTLTKPVIYISIGEIINTHTLLLDHQDAIAPEHNDPIHELLDDLGEVPT
IESLIGEGSGNVNDPNREMLAKTEVSLTLTNKFDVPGDENAEMDARTILLNTKRLIVDVI
RFQPGETLTEILETPATSEQEAEHQRAMQKRAIRDARTPDKMKKSMSVREDSNLNLQGKK
EKIKTGLKKLTELGIVNAKNKYQELINDIAKDIRNQRRYRQRRKAELVKLQQTYSALNSK
ATFYGEQVDYYKSYIKTCLDNLASKGKVSKKPREMKGKSSKKISLKYTAARLHEKGVLLE
IEDLQVNQFKNVIFEISPTEEVGDFEVKAKFMGVQMETFMLHYQDLLQLQYEGVAVMKLF
DRAKVNVNLLIFLLNKKFYGK
Download sequence
Identical sequences U3IUX2
ENSAPLP00000011045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]