SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000011084 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000011084
Domain Number 1 Region: 540-752
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.44e-50
Family DBL homology domain (DH-domain) 0.00028
Further Details:      
 
Domain Number 2 Region: 233-377
Classification Level Classification E-value
Superfamily PH domain-like 1.2e-42
Family Third domain of FERM 0.00047
Further Details:      
 
Domain Number 3 Region: 888-1031
Classification Level Classification E-value
Superfamily PH domain-like 6.43e-33
Family Pleckstrin-homology domain (PH domain) 0.0021
Further Details:      
 
Domain Number 4 Region: 737-861
Classification Level Classification E-value
Superfamily PH domain-like 4.88e-31
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 
Domain Number 5 Region: 132-232
Classification Level Classification E-value
Superfamily Second domain of FERM 6.8e-28
Family Second domain of FERM 0.00014
Further Details:      
 
Domain Number 6 Region: 52-132
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.1e-19
Family First domain of FERM 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000011084   Gene: ENSAPLG00000011291   Transcript: ENSAPLT00000011805
Sequence length 1036
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB744591.1:110498:178115:-1 gene:ENSAPLG00000011291 transcript:ENSAPLT00000011805 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEIEGTYRVLQTPGSRLGVQKNSGVSTLEPGQNLSTAMSSPAKTHEKDLQVKIKMLDNT
VEVLDIESKYYGQALLTEVYKHLNLNESDYFGIEFQNIQSYWIWLEPMKPVIKQVRRPKT
TMLRLAVKFFPPDPGQLQEEYTRYLFALQIKRDLAEERLTCSDNTAALLISHLLQSEIGD
FDESEDREHLKTNQYLPNQERIQGKILEFHRKHVGQTPAESDFQVLEIARKLEMYGIRFH
LASDREGTKINLAVSHMGVLVFQGNTKINTFNWSKVRKLSFKRKRFLIKLHPEVCGPYQD
TLEFLLGSRDECKNFWKICVEYHTFFRLFDQPKPKAKAVFFTRGSSFRYSGRTQKQLVDY
IKDSGMRKTPYERRHSKVRVSTHASNTDVPKQSVAFTEGLRTPGSPASATVPFHSFHSSA
TPTTVLPIFAETSPSSLDPRVPYTRIPEKNTAAPVEETGRKSMQQPGSPTFQSFQGLPVD
HSQLSSLVLKSPLGLNTVFQVNLNAAGQGSSPLLSPVLSDAGGARIEEDDEMKRKRYPTD
KAYFIAKEILATERTYLKDLEVITVWFRSAVIKENAMPEGLMTLLFSNIDPIYEFHRGFL
KEIEQRLSLWEGKTNAHMKGDYQRIGDVMLRNMRTLKEFTSYLQKHDEVLTELEKATKRL
KKLEMVYKEFELQKVCYLPLNTFLLKPIQRLMHYKLILGRLCKHYTAEHRDFADCRNALK
EVTEMTSQLQHSLIRLENFQKLTELQHDLIGIDNLTAPGREFIREGCLYKLTKKGLQQRM
FFLFSDMLLYTSKGVTGTNQFKIHGHLPLHGMLVEESENEWAVPHCFTIYSAQKTIVVAA
STRLEMGKWMEDLNMAIEMAKKSTEKSDMLLDNSVCNRSNRSSDEVSLEQESEDDIHSSR
SSLDRQSHHRANTTMHVCWYRNTSVSMTDHSVAVENQLSGYLLRKFKNSNGWQKLWVVFT
NFCLFFYKTHQDDYPLASLPLLGYAVSSPVEADGIQKDYVFKLQFKSHVYFFRAESKYTF
ERWMEVIKRATSSPAR
Download sequence
Identical sequences U3IV11
ENSAPLP00000011084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]