SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000011113 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000011113
Domain Number 1 Region: 191-294
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 8.98e-35
Family ets domain 0.0000945
Further Details:      
 
Domain Number 2 Region: 9-116
Classification Level Classification E-value
Superfamily SAM/Pointed domain 8.98e-25
Family Pointed domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000011113   Gene: ENSAPLG00000011349   Transcript: ENSAPLT00000011835
Sequence length 299
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742537.1:125066:137227:1 gene:ENSAPLG00000011349 transcript:ENSAPLT00000011835 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILEGAGRMSINSSSNLLHQQPSWTDGYSTCNVSSSFYGTQWHEIHPQYWTKFQVWEWLQ
HLLDTNQLDANCIPFQEFDINGEHLCSMSLQEFTQAAGTAGQLLYSNLQHLKWNGQCGSD
MYQSHNVIVKTEQTDPSLMVSWKEENYLYDSGYGSTVELLDSKTFCRAQISMTTPSHQPP
DSSDVKKTQDHTPKSHTKKHNPRGTHLWEFIRDILLNPEKNPGLIKWEDRSEGVFRFLKS
EAVAQLWGKKKNNSSMTYEKLSRAMSRYYYKREILERVDGRRLVYKFGKNARGWRENEN
Download sequence
Identical sequences U3IV40
ENSAPLP00000011113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]