SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000011174 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000011174
Domain Number 1 Region: 3-224
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.79e-59
Family Ankyrin repeat 0.0000582
Further Details:      
 
Domain Number 2 Region: 759-830
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.4e-18
Family SAM (sterile alpha motif) domain 0.0066
Further Details:      
 
Domain Number 3 Region: 834-878
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000216
Family SAM (sterile alpha motif) domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000011174   Gene: ENSAPLG00000011425   Transcript: ENSAPLT00000011897
Sequence length 879
Comment pep:novel scaffold:BGI_duck_1.0:KB743625.1:459776:687936:-1 gene:ENSAPLG00000011425 transcript:ENSAPLT00000011897 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IWRGPNINCTDSSGYTALHHAALNGHKDIVLKLLQYEASTNVADNKGYFPIHLAAWRGDV
DIVKILIHHGPSHSRVNEQNNENETALHCAAQYGHSEVVAVLLEELTDPTIRNNKLETPL
DLAALYGRLRVVKMIIKAYPNLMNCNTRKHTPLHLAARNGHKAVVQVLLEAGMDVSCQTE
KGSALHEAALFGKVEVVRILLETGIDTNIKDSLGRTVLDILKEHPSQQSLQIAALLQEYM
ETGNASVSEERPLECAEHQSCILSPEVPPSPKAKSEAVTGELSKLLDEIKLCQEKEYSFE
DLSHTISDHYLDNFSKISEEELMTSGSQTKLNVVKRPASTCLSTREEEEDDVGENTCGPS
GIWEALTPCNGCRNLGFPMLAQESYSKKRGYALETIPSAPLDAVPSENDNSLCDSVDIAV
TKKPCSLEIARVPSSRPDNAPQVAITAPGSGNHRNSSTGPTPDCSPPSPDTALKNIVKVI
RPQPKQRTSIVSSLEFHRTNHSHDYFEINSSIACTSFISTPAISPPNYSFGSLEDSVEER
ELTGIGETSTESELPEGHPAEQFAGLLHGSSPACDPPDNPLQLYSKINQCSSPLEKNILS
KSTVQQIQLQKENNPDPPVKKKKPQVVNRTIFHTKTKPVENHTLVGTSTRISEQWVITTG
GFVERACTLGRIRSLPKTLLEMHLYKNVSKSDSNLITHPPSDKKARSNWSEPTPNQQCSK
GNSERTPSFTSEWEEIDKIMSSIDAGINTGLGEMNDHATRPRCPVQTVGQWLENIGLPQY
ENHLLANGFDNVQFMGSNVMEDQDLLEIGILNSGHRQRILQAIQLLPKMKQIGHDGYNPT
SVAEWLDSIELGDYTKSFLINGYTSMDLVKKIWEIELIN
Download sequence
Identical sequences U3IVA1
ENSAPLP00000011174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]