SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000011214 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000011214
Domain Number 1 Region: 283-489
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.42e-49
Family BCR-homology GTPase activation domain (BH-domain) 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000011214   Gene: ENSAPLG00000011409   Transcript: ENSAPLT00000011937
Sequence length 631
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742432.1:1482234:1517603:1 gene:ENSAPLG00000011409 transcript:ENSAPLT00000011937 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NSRRSGQYTMNHDNSKKTPDGASVDRSGSQDSLDELSLDDYFKEIENIHETRRNNHEERE
ALVVKEPDEGELEEEWLKEAGLSNLFGESTGDSQESMVVLSTLTRTQKAAVEKRVETVTQ
TLRKKNKHHQIPDVRDIFRLQSDPKEKVCDENEPSAVRTTENRSGTQDETKGPKFSVGTN
EQKTPPQDMPFSETDLNLEIPFAEQAANTKDSSVGKMCKGGGGDTLPLNFRLPKDKTGTT
KIGDLAPQDMKKVCSLALIELTALYDVLGTEFKQQKAAKIKTKDSGLFGVPLSVLLEQDQ
KKVPGTKIPLIFQKLISQIEEATLETEGLLRIPGVATRVKTLCQELEAKFYEGTFNWENV
KQHDAASLLKFFIRELPQPLLTVEYLKAFQDVQNLPTKKQQLQALNLLVILLPEANRDTL
KVLLEFLQRVIDHRDKNKMTLNNVAMVMAPNLFTFHGFGSKTIEQSEFVMAAGTANVMRF
MIQHQKLLWTIPKFLVNQVRKQNAESQKKEKKDKAMKKLLKKMAYDREKHEKQDKVPNDA
DVPQGVIRVQAPHLSKVSMAIQLTEELKASDIVARFLSQKSGNVQTLKKEEVFLYEIGGN
IGERCLDDDTYMKDLYQLNPNAEWVIKPKQS
Download sequence
Identical sequences U3IVE0
ENSAPLP00000011214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]