SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000011248 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000011248
Domain Number 1 Region: 3-70
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000148
Family RING finger domain, C3HC4 0.017
Further Details:      
 
Domain Number 2 Region: 147-222
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000222
Family APG12-like 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000011248   Gene: ENSAPLG00000011489   Transcript: ENSAPLT00000011971
Sequence length 229
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB744008.1:57022:75032:1 gene:ENSAPLG00000011489 transcript:ENSAPLT00000011971 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAELTPYILCSICKGYFIDATTITECLHTFCKSCIVRHFYYSNRCPKCNIVVHQTQPLYN
IRLDRQLQDIVYKLVVNLEEREKKQMHDFYKERGLEVPKPGYLNILAVPQPVPASRGRPR
KVLGSVFRIPPELDISILLEFIGANEGTGNFKPLEKKFVRVSGEATIGHVEKFLRRKMDL
DPACQVDIICGDHLLEHYQTLREIRQVIGESAVQDGLLVLHYGLVVSPL
Download sequence
Identical sequences U3IVH4
ENSAPLP00000011248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]