SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000011296 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000011296
Domain Number 1 Region: 286-416
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 6.41e-44
Family Regulator of G-protein signaling, RGS 0.000000225
Further Details:      
 
Domain Number 2 Region: 17-115
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.06e-23
Family DEP domain 0.011
Further Details:      
 
Domain Number 3 Region: 220-277
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 0.000000000000144
Family Transducin (heterotrimeric G protein), gamma chain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000011296   Gene: ENSAPLG00000011394   Transcript: ENSAPLT00000012020
Sequence length 661
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742832.1:1120523:1147264:-1 gene:ENSAPLG00000011394 transcript:ENSAPLT00000012020 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSIKEKCCGVRPVKKIKEKIEALMMEMQNPDTGIKTQTQRVMITNIPHAVAGNDILQWIL
QRLQITDEEALHLGDLFVKYGYIYPLQEPKNLTLKTDGSLYRFQQTPYFWPTQSWPADDT
DYAIYLAKKNIKRKGILEEYEKEHYNMLNKKINYKWDFVIMQAKEQYKAGKERKKADRYA
LDCQERAYWLVNRTPPGMLDVLEYGLDRATDPNENKKKTMDVYRREIMYYQQAIMKSRVK
SSVSLGGLVKYSEQFLSNDPILSGCLPSNPWVTDDPEFWDLNAKLVEVPTRMRVERWAFN
FSELIRDPKGRQNFQLFLKKEFSGENLSFWEACEDLKYGDQSKVKEKAEEIYKLFLAPGA
RRWINIDGTTMGITVKGLKHPHRYVLDAAQTHIYMLMKKDSYGRYLKSPIYKEMLAKAVV
PQETVKKSSNFPFGRRQLRSSPSPVILRQQEEEAKAKEAATTVDITQPSPEQGRAPSQGV
QSGHPPERSSHINSPSAIGHPKYPPPPSHCRRVTDTACPSPISVALDSTAGTEREQDPGG
AIPSPFPDKVGAAAPAMAALSLRRFLRRGCLNSPVFATLSPRCPTMPHGKVQPLGERERR
LRQDAKAVSSFFQIKMDVPLERRIYPVDSAEEELKCHQVCKESAKEVICPWESPAEEGRA
G
Download sequence
Identical sequences U3IVM2
ENSAPLP00000011296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]