SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000011511 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000011511
Domain Number 1 Region: 620-727
Classification Level Classification E-value
Superfamily SH2 domain 7.14e-32
Family SH2 domain 0.0000029
Further Details:      
 
Domain Number 2 Region: 123-298
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.08e-30
Family BCR-homology GTPase activation domain (BH-domain) 0.0000158
Further Details:      
 
Domain Number 3 Region: 329-435
Classification Level Classification E-value
Superfamily SH2 domain 1.28e-29
Family SH2 domain 0.00000203
Further Details:      
 
Domain Number 4 Region: 3-81
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000108
Family SH3-domain 0.0000403
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000011511   Gene: ENSAPLG00000011675   Transcript: ENSAPLT00000012240
Sequence length 729
Comment pep:novel scaffold:BGI_duck_1.0:KB744335.1:16861:28174:-1 gene:ENSAPLG00000011675 transcript:ENSAPLT00000012240 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
STDGFQYRALYPYRKEREEDIDLLPGDILVVSKGALQALGFKDGDEQNPNQIGWILGVNE
RTKQKGDFPGTYVEYVGPVKISVPSHRPRGPAGGVPQPFPSCPPPRSAASSLSPSSPGSP
LPDLQEQFSPPEIAPPLLVKLVEAIEKKGLDSEMLYRTSGSELRQALRTDWSLGDLEPFD
VHSLGEALRGYLQDLPSPVVPVAVHGDILRVLQEVPQPENCRKQLLLALESPAVPLQNTL
TLQFLLRHLGKVSQQAESNNLHPRALGEIFGPLLLRLPGASPELSPDFSVLFLEMLLQLK
ELEPEQLPPALPPKPPKPKPSAASLANGNSVPLQDAEWYWGDISREEVNEKLRDTPDGTF
LVRDASSKIQGEYTLTLRKGGNNKLIKIFHREGKYGFSEPLTFGSVVELITHYRHESLAQ
YNAKLDTRLLYPISKYQQDQVVKEDSVEAVGEQLKVYHQQYQDKSWEYDLLYEEYTRTSQ
LQMKRTAIEAFNETIKIFEEQCQTQEKCSKEYIERFRREGNEKEVQRILMNSEKLKSRIT
EIHDSKMKLEQDLKKQASENREIDKRMNSLKPDLMQLRKLRDQYLVWLTQKGARQKKINE
WLGIKNETEDQYSMMDDEEELPHHEERTWYVGKINRLQAEEMLCGKRDGTFLIRESSQKG
CYACSVVVDGDTKHCVIYKTASGYGFAEPYNLYASLKDLVLHYKHTSLVQHNDSLNVTLA
HPVLSQPPA
Download sequence
Identical sequences U3IW86
ENSAPLP00000011511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]